Iron sulfur clusters

From genomewiki
Jump to: navigation, search

Introduction

The surprisingly numerous nuclear proteins containing 4Fe-4S clusters are made from their respective apoproteins in the cytoplasm during the final stages of an assembly process that begins within mitochondria and ends with an embedded cluster in polymerases, helicases, primases, telomerases, and photolyases with no explained need for a cofactor otherwise associated with oxidation and reduction.

These 4Fe-4S clusters do not spontaneously associate with their target protein because they do not occur in free solution, being quite unstable to unwanted oxidation. Instead, nascent clusters are attached to a series of mediating proteins, carrier scaffolds and conformational chaperones throughout a complex process of maturation. That process and the gene products involved -- which are conserved from yeast to human -- have been recently reviewed in depth and new results (1,2) have clarified the roles of the four main protein components that collaborate on the final stage of cytoplasmic assembly.

Not all extra-mitochondrial 4Fe-4S cluster proteins are assembled in this pathway, but the molecular basis for specificity has not yet been determined. Indeed, a surprising number of proteins -- some studied for decades -- have only been recognized as iron sulfur proteins in 2011-12.

Indeed, the list of proteins is still incomplete because many unrelated homology classes have Fe-S clusters, meaning no single diagnostic pattern can be used to scan the entire proteome. Often four conserved cysteines coordinate the cubane complex but their spacing within the primary sequence is not uniform and difficult to distinguish from cysteine patterns that bind intrinsic zinc. Further confusing matters, seemingly artifactual zinc can replace bona fide 4Fe-4S clusters in proteins purified for crystallography in the presence of oxygen (1,2,3).

The early and middle stages of intra-mitochondrial iron sulfur cluster assembly are carried out by gene products of bacterial origin, relics of alphaproteobacterial endosymbiosis transferred long ago to the nuclear genome. However, not all components of final cytoplasmic assembly have such a clear origin whereas most targeted apoproteins (such as primase large subunit PRIM2) are clearly those of the archaeal parent. Thus the final stage of assembly presents two worlds in collision: bacterial proteins assembly iron sulfur clusters in unfamiliar archaeal proteins.

Bioinformatics, while a poor substitute for experimentation, is fast and easy, so it is best to exhaust the possibilities there first. Nothing is proven but sometimes it can suggest interesting directions.

MMS19: a large all-scaffold protein

MMS19 is a large protein involved in cytoplasmic iron sulfur assembly first studied with bioinformatic tools 12 years ago (1,2). Revisiting that with modern comparative genomics methods, MMS19 emerges as a modular scaffolding protein over its entire length, conserved in its features -- though not particularly in amino acid sequence -- from the earliest diverging eukaryotes to human.

The C-terminus of MMS19 was initially classified as HEAT repeats. Today we know these are not found as individual units but instead work together to form a long twisted spiral of consecutive modules called an ARM domain. An individual HEAT unit consists of a small 3-helix bundle, a generic super-secondary structure analogous to a beta-alpha-beta Rossmann fold unit, meaning most occurrences of HEAT in the eukaryotic proteome are not truly homologous despite structural similarity but instead represent convergent evolution analogous to Rossmann-like fold units forming many unrelated beta propellers or TIM barrels.

Since these domains are catalytically inert and lack conserved cysteins or other conserved motifs, MMS19 can contribute as organizing principle to the cytoplasmic iron assembly complex (and other nuclear complexes) but not to the actual business of forming 4Fe-4S on target apoproteins.

The size of MMS19 -- over a thousand residues -- makes it a difficult target for structure determination. As of June 2012, no deposited structure at PDB provides a template upon which the MMS19 can be threaded. In the interim, MMS19 might be structurally modeled using the known beta-catenin structure -- despite its lack of authentic homology, it too is comprised almost entirely of HEAT units.

The number of HEAT repeats in an ARM domain is subject to expansion and contraction over evolutionary time. The individual units often align poorly with each other and generally lack conserved residue signatures despite initial reports, yet this level of variation does not necessarily affect the overall fold. However, this lack of diagnostic features makes it difficult to reliably identify remote homologs of HEAT repeats because the primary sequences can be diverged beyond recognition and homological alignments go out of register when the number of repeats differs.

An accurate count of the number of individual HEAT domains in MMS19 from a given species is also difficult because some domains are more accurately represented in the HMMer profile than others, here giving different counts between mouse and human at UniProt despite 90% sequence identity over their entire length. Indeed the five species with manually reviewed UniProt entries are all in conflict, with the nominal number of HEAT units range from 7 in human to 18 in slime mold, despite similar lengths and overall alignment implying the same actual domain structure.

MMS19 is a single-copy gene without paralogs in all eukaryotes, implying simple orthology (no retained duplications or losses). Below, 20 full length fasta sequences from GenBank were chosen for uniform distribution over the eukaryotic phylogenetic tree. Superfamily proved to be the most consistent, sensitive and selective online tool for ARM domain detection. The figure at bottom establishes that MMS19 consists entirely of HEAT units and spacers, which in effect form a single ARM.

It emerges upon alignment with MultAlin that conservation is mediocre overall except for one previously notedspecial region of exceptional conservation containing two blocks of invariant residues from human to yeast to amoeba. This region must have already been established in the last common ancestor of all eukaryotes and play a very special role in MMS19 even today to account its conservation over trillions of years of cumulative branch length. However that role remains a complete mystery. Sequence conservation in MMS19 is otherwise not exceptional: typically 27-34% identity relative to human, of which some portion is accidental.

Ultra-conserved region in MMS19:

human: 182 DGEKDPRNLLVAFRIVHDLISRDYSLGPFVEELFEVTSCYFPIDFTPPPNDPHGIQREDL 241
yeast: 184 NGEKDPRNLLLSFALNKSITSSLQNVENFKEDLFDVLFCYFPITFKPPKHDPYKISNQDL 24 

Regardless of Blast query -- full-length MMS19, this ultra-conserved region, or reconstructed ancestral sequence -- no counterpart to MMS19 occurs among 2,500 complete bacteria and archaea genomes, even though unambiguous orthologs to human MMS19 are readily found in the earliest diverging eukaryotes. MMS19 may thus represent a eukaryotic innovation needed to organize more complex cytoplasmic iron assembly, or be too simplified and diverged (or just lost) in prokaryotes. As method of last resort, prokaryotic operons containing other cytoplasmic iron sulfur assembly proteins could be scanned for adjacent HEAT-like domains or comparable scaffolding proteins.

click to enlarge

There are no matches to MMS19 at PDB using Blastp. Since the fold is widespread and generic, structural matches in DALI do not imply homology. On the other hand, this allows the crystallographic structure of a non-homologous ARM protein (beta-catennin pdb: 1LUJ) to serve as provisional structural template. Bound E-cadherin, ICAT, XTCF3 complexes have been also been determined which may suggest a binding mode for cytoplasmic iron sulfur and helicase-type proteins on HEAT repeats of MMS19.

MMS19 could determine selectivity among the overall set of iron sulfur apoproteins if only those interacting with DNA (or comparable nucleotide) have binding propensity for HEAT units. This specificity would then vary by organism, as would the effects of knock-in replacement. Only those apoproteins that align along the linear scaffolding structure in close enough proximity to CIA effector proteins receive an iron sulfur complex. Not every protein arising in this context need directly bind a HEAT domain -- they could bind another protein with that capacity.

This scaffolding scenario requires multiple non-homologous proteins to have HEAT binding sites, which seemingly requires convergent evolution on a significant scale since a shared mobile binding domain can be ruled out. If MMM19 is truly a eukaryotic innovation, then cytoplasmic iron assembly complex initially functioned without the scaffolding until MMS19 and these binding sites evolved.

That seems implausible, so some other common ground must account for HEAT binding. One option, based on the super-helical configuration and major groove of the overall ARM domain, supposes that that MMM19 spoofs a DNA helix or nucleotide base in shape and charge (along the lines of W536 in CRY1B photolyase). This would explain most of the specificity -- each archaeal apoproteins of DNA metabolism needing an iron sulfur cluster already has a DNA binding site, so already an appropriate MMM19 HEAT binding site.

In early endosymbiosis, retained bacterial cluster assembly machinery collides with nuclear-encoded archaeal iron-sulfur protein motifs previously maturated by a different system, a conflict that had to be seamlessly resolved without ever a gap in continued functionality.

CIAO1: a WD40 multi-protein scaffold

The bioinformatic analysis of CIAO1 is straightforward: it consists of a WD40 domain in its entirety. There is no CIAO2 -- this is a single-copy gene in all eukaryotes. These ubiquitous 7-propeller blade domains can arise in non-homologous proteins as a common supersecondary structure rather than from spread of a mobile domain -- the human genome encodes some 257 proteins with a WD40 repeat. However a degree of coincidental sequence alignment can arise from common constraints (such as a conserved glycine/histidine and the tryptophan/aspartate pairs).

WD40 domains are not catalytic and so, like MMS19, not involved here mechanistically in Fe-S formation, transfer or repair. Thus CIAO1 is likely a structural scaffolding protein coordinating larger multi-protein complexes, so its acronym (Chinese for bridge) is appropriate. Crystallographic structures have been determined both in yeast PDB: 2HES and human PDB: 3FM0.

click to enlarge

Strongly conserved surface residues -- which likely mediate oligomeric interactions -- mostly lie on the top and one side of CIAO1. Despite this, of four substitutions tested, only R127E (purple) affected in vivo functionality, as assayed bu plasmid rescue of CIAO1 depleted cells and levels of the assembled Fe-S protein isopropylmalate isomerase. This does not explain observed conservation of other surface residues such as K16, R34, E54, E197 and R251 which are unlikely to play a role in internal structure or stability.

No journal article ever accompanied the human structural determination but differences from yeast are likely minor in view of demonstrated replacement capability. Since human CIAO1 forms a hetero-oligomer with FAM96A and likely FAM96B as well, this suggests yeast CIAO1 forms a similar oligomer with its counterpart yeast FAM96B consistent with the late role of CIAO1 in cytosolic FeS assembly.

It is thus feasible to separately determine conserved residues in FAM96A and FAM96B using ConSurf. Their common ground would then include the binding site for CIAO1, presumably either its previously established conserved top or side residues. Since FAM96B forms a domain-swapped dimer and CIAO1 binds stoichiometrically, a symmetric heterotetramer can be expected.

However nothing is accomplished in terms of coordinated docking unless CIAO1 has a second binding site for another component of cytosolic FeS assembly. CFD1 is a possibility here in view of the CFD1-CIAO1 fusion protein in S. pombe, as are NBP35, ERCC2 and ANT2.

click to enlarge

CIAO1 has weak blast matches in both bacteria and archaea but these are not associated with any of the three iron sulfur cluster assembly system operons (ISC, SUF, NIR) and may simply represent convergence in WD40 proteins. Matches to early-diverging eukaryotes -- a half dozen are provided below -- are much more persuasive because back-blastp to human uniquely recovers CIAO1. These exhibit extensive conserved regions considering the immense phylogenetic span and rapid evolution of some clades. Narrowly ineage-specific indels, presumably in loop regions, can be removed to create an idealized alignment that better reflects conserved residues.

FAM98B is homologous to bacterial SufT

FAM96B is remarkably conserved throughout eukaryotes. It duplicated in the earliest metazoan ancestor, giving rise to FAM96A after the divergence of choanflagellates but before those of sponge, trichoplax, ctenophore or cnidarian. Both FAM96B and FAM96A have been retained in all metazoan lineages. In vertebrates but not earlier diverging deuterostomes, FAM96A acquired an unmistakable signal peptide, meaning it was no longer targeted to the cytoplasm. The species with the signal peptide are exactly those with an extra pair of invariant cysteines, suggesting a disulfide suitable for an oxidizing subcellular compartment such as endoplasmic reticulum.

However these new cysteines are not in proper crystallographic position to form a disulfide, though the new Cys99 and the long conserved near-terminal Cys155 are within range and may form a disulfide under certain conditions. A disulfide between Cys99 and Cys155, while physically plausible from 3UX2 and signal peptide, is however not evolutionarily plausible because the counterpart of Cys155 in FAM96B is a long-conserved surface residue for another reason.

The positions of two Cys90, one from each monomer, may also be capable of forming a disulfide, 2Fe-2S, or zinc ligand provided the protein is purified anaerobically or reconstituted using some sort of activity assay. The phylogenetic conservation of cysteines is explored in the alignment below.

The two encoded proteins both bind CIA01. However they must have distinct functions in vivo to account for their retention in so many lineages for so long. The usual explanations -- specialized time of expression during development or in differentiated populations of cells -- is not generally applicable from single-celled organisms to human. Since the signal peptide in FAM96A arose fairly late, it too cannot explain retention in earlier diverging species. (Note however tools that recognize signal peptides are not adequately trained on these species.) Since the duplication is restricted to metazoans (ie animals), it could possibly be associated with dietary, rather than diffusive, acquisition of iron. Secondary duplications of FAM96B occurred in various lineages (eg insects, slime molds).

The placement and phase of introns in FAM96B and FAM96A -- largely conserved -- implies that FAM96B was largely intronated prior to gene duplication. Although the two genes did go their separate ways during the subsequent 600 million years (both gains and losses of introns occurred), the patterns remain very closely related today even comparing human to sponge. Most remarkably, the first intron was already present in early diverging stramenopiles (eg Phytophthora infestans) and the last exon in the last common ancestor of human and amoebozoa (eg Dictyostelium discoideum). Convergent evolution is implausible given 450 possibilities (three possible phases at 150 sites).

Intron position and phasing (00 12 21) in FAM96B and its early metazoan duplicate FAM96A: 

FAM96A_homSap WLSGLSEPGAARQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD
FAM96A_sacKow MNKDETLRIKGAEDDQEKELAEEIYDIIRTIRDPEKPQTLEDLDVVYEDGVLVNHRGTDEFLVNVEFTPTVPHCTLATLIGLCIRVKLQRTLPHSYKLDIFIKKGTHSTEDEINKQINDKERIAAAMENPNLKDLVDNCVVDLE
FAM96A_triCas EFEDSPRKEVKEVSEDDSELKYTVYDLIRTIKDPEKPNTLEELNVVYEEGEVKERTSGNVSVVRVEFNPTVPHCSLATLIGLCIRIKLERCIPYRIKLDIYIKAGAHTTEHEINKQINDKERIAAAMENPNLREMVENCIVEED
FAM96A_nemVec PSFGASRIDNDVNSQSNRNLALDVYDLIKDIKDPEKPQTLEDLKVVYESCVEVQKVAGQDHITIT FTPTVPHCSLATLIGLCIRVKLEKSLPEKFKLDIYLKKGTHSTENEINKQINDKERIAAAMENPNLRKIVENCIDEDN
FAM96A_acrPal MSENKILSTAADSSFDNLVLVQEVFDIVKDIRDPELPQTLEELHVIEEEFIKIDKIENDEYIIKIEFTPTVPHCSLATLIGLCLRVKLERSLPYKFKLDIFLSRGTHSTENEINKQINDKERIAAAMENPNLKKIVEECILDAN
FAM96A_triAdh                          ELIRDIKDPELPQTLEELNVVTEDEIFVRNMKQGEACIRINFTPTVPHCSLATLIGLCIRVKLQRCLDQDYKLDIYVTKGSHDTEDGVNKQINDKERVAAAIENPNVKKLVEECLQEVQ

FAM96B_homSap SGERPVTAGEEDEQVPDSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRVQVSDPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKERVAAALENTHLLEVVNQCLSARS
FAM96B_braFlo TSEREVTPEELNEDVEDAIDAREIFDILSSINDPEHPLTLEELNVIEQSRITVDEDNNHVSVEFTPTIPHCSMATLIGLSIRVKLLRALPTRFKVDVHITPGTHQSEHAVNKQLADKERVAAALENQHLLEVVNQCLSTRN
FAM96B_droMel IKERVLTANEEDENVPDPFDKREIFDLIRNINDPEHPLTLEELHVVQEDLIRINDSQNSVHISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVNKQLADKERVAAALENNHLAEVINQCIAKG
FAM96B_nemVec LKERVVLAEEEDDNIVDKIDDREIFDMIRSINDPEHPLTLEELNVVEQALIDVSDDESYVKVQFTPTIPHCSMATLIGLAIRVRLLRSLPDRFKVDVKITPGTHQSEIAVNKQLADKERVAAALENNHLLDVIDQCLVSKK
FAM96B_triAdh SKEREILPEELDDNIVDKIDEREIFDIIRSINDPEHPLTLEELNVVEECKIDVDDDNNFVKVHFTPTIPHCSMATLIGLCIRVRLIRSLPERFKVDITVTPGSHSSEIAVNKQLADKERVAAAMENSNLLKVVNQCLAMD
FAM96B_ampQue AKQRPVTVEEEKDDVYDEIDAREVFDLIRHINDPEHPLTLEELNVVQEDLICINNKENFVSVHFTPTIPHCSMATLIGLSIRVCLLRSLPNRFKIDVIITPGSHMSEQAVNKQLADKERIAAAIENSHLLNVVHQCLNTKR
FAM96B_monBre VQERVTLDNDFDDDVIDPFDSREIFDLVRHINDPEHPLTLEELNVVRLDQILVDDAQNYVRVQFTPTIPHCSMASLIGLCLRVRLLRALPPRFKVDVEIFPGTHATEASINKQLADKERVAAALENPNLKTVVNECLQLDD
FAM96A.png

FAM96B and FAM96A are essentially comprised of a single domain of unknown function, DUF59, a fall-out of automated primary sequence clustering. DUF59 is not a common building block in proteins -- FAM96B/FAM96A are the only human proteins in an 18,500 member proteome to contain it. Thus it is remarkable that the top -- if weak -- Blastp matches of FAM96B to prokaryotes are to a DUF59 domain in the bacterial SufT gene. SufT is part of a large operon of an alternative system for formation of 4Fe-4S proteins. Further, a SufT-related domain occurs in Q6STH5 of Arabidopsis thaliana (in chloroplasts, cyanobacterial endosympbiont proteins assemble Fe-S complexes) fused N-terminally to a homolog of NUBP2/CFD1 which participate in cytosolic Fe-S cluster assembly. Recall CFD1 is fused to CIAO1 in S. pombe, consistent with the three proteins forming a heteromeric complex.

Is DUF59, defined by a subtle primary sequence profile, a valid domain? Four independent crystallographic structures all have the same fold (ie low DALI-defined rmsd deviations), as do template-threaded structures. Additionally SufT is located within a SUF operon in at least three genera of bacteria as SufABCDSUTR in Ralstonia, Cupriavidus and Pseudogulbenkiania -- this can't be coincidence given the rarity of the DUF59 domain and involvement of both FAM96B and SufT in iron sulfur cluster formation. Thus although human FAM98B and bacterial SufT have borderline alignable primary sequences, five lines of evidence support bona fide homology, a surprising result because it mixes (eg within human) a component of the 'backup' bacterial SUF system of iron sulfur complex formation with elements descended from the main bacterial ISC system.

Gene    PDB    UniProt   PubMed             Species               Comment

FAM96A  3UX2   Q9H5X1    22683786,2261886   Homo sapiens           cytosolic 4Fe-4S cluster formation
FAM96B '3UX2'  Q9Y3D0    22678362,22678361  Homo sapiens           from FAM96A utilizing >50% sequence identity
DUF59   1WCJ   Q9WYV7    16199668,15213465  Thermotogo maritima    216 homologs TM0487 1UWD 
DUF59   3CQ1   Q53W28    --------           Thermus thermophilus   dDTP-4-Keto-L-Rhamnose reductase-related TTHB138, aka 2CU6
DUF59   3LNO   Q81XF6    --------           Bacillus anthracis     article never published
SufT    ----   AM260480  --------           Ralstonia eutropha     iron sulfur cluster assembly protein
PaaD   '3CQ1'  G8RCQ5    16199668           Staphylococcus aureus  aromatic ring hydroxylating enzyme Fe-S assembly
YITW
HCF101  ----   Q6STH5    14690502,19817716  Arabidopsis thaliana   chloroplast 4Fe-4S cluster formation
SufT.png


Phenylacetate catabolism: click to enlarge
SufT alignment: click to enlarge
Triple fusion DUF59-NUBPL-Duf971 (HCF101): click to enlarge
Archaeal NUBP1 NBP35 dimer CxxC pair Zn: click to enlarge
PaaD alignment: click to enlarge
DUF59 structural comparison: click to enlarge

If more were known about the specific role of SufT in iron sulfur cluster metabolism, that would likely transfer directly to human FAM96B and FAM96A. Although little is known today, SufT may be more easily studied in bacterial genetic systems than FAM96B. Not all bacterial DUF59 domains reside in Suf operons. While the correspondence to FAM96B is not as clear, some of these domains are exceedingly well-studied. Insights into FAM98B/SufT function may thus come from the phenylacetic acid degradation pathway -- a seemingly unrelated topic but one that involves a DUF59 domain.

Here, a colossal annotation error has propagated to thousands of GenBank and UniProt entries -- the DUF59 domain of the phenylacetate catabolic pathway actually resides in PaaD, not PaaJ (a non-homologous protein with only thiolase domains). Utilizing E.coli accession P76080 as valid starting point for PaaD, 85% of the Blastp matches are mislabeled PaaJ. The PaaD protein is obviously not the product of the PaaJ gene as many entries state. This situation -- seemingly impossible to fix -- illustrates the dangers of unattended computer annotation.

>PaaD_escCol Escherichia coli 1 Duf59 conserved cysteine 6 other conserved cysteines P76080 PaaJ ydbQ DUF59 unacceptable synonym: PaaJ 
MQRLATIAPPQVHEIWALLSQIPDPEIPVLTITDLGMVRNVTQMGEGWVIGFTPTYSGCPATEHLIGAIREAMTTNGFTPVQV
VLQLDPAWTTDWMTPDARERLREYGISPPAGHSCHAHLPPEVRCPRCASVHTTLISEFGSTACKALYRCDSCREPFDYFKCI*

The initial aromatic ring oxygenation (using O2, not water) is accomplished by a multi-subunit complex requiring PaaA, PaaB, PaaC and PaaE for in vitro reconstitution of catalytic activity. PaaD has no place in the complex but an essential role in vivo as established by mutation and supported by position within the Paa operon in many species.

Together, this suggests the DUF59 domain of PaaD establishes and/or repairs the 2Fe-2S cluster of PaaE reductase which might be especially vulnerable to reactive oxygen species produced in ring cleavage. This presumed role for PaaD is thus not a great departure from what its homologs FAM96A and FAM96B do in eukaryotes -- the difference being DUF59 acts on a broad class of iron sulfur apo-proteins when it resides in a SufT-containing operon, whereas it acts narrowly on a specific phenylacetate catabolism reductase when located in the associated Paa operon. Note PaaA itself has a possibly relevant di-iron center though its regulatory paralog PaaC does not.

The PaaD protein contains an N-terminal DUF95 domain, at best 38% identical and 55% similar to FAM96B, sharing the single universally conserved central cysteine and a few but not all additional motifs. Following a non-conserved spacer, a strongly conserved C-terminal region of 41 residues containing 6 invariant cysteines emerges. While not a known domain and not found outside bacteria, it suggests an iron-sulfur carrier functionality. Outside of bacteria, PaaD has weak blast matches to assorted DUF59 domains. Thus since its divergence from a common ancestral protein with FAM96B billions of years ago, PaaD has become restricted and highly adapted to the bacterial aromatic catabolic pathway.

The DUF59 domain appears in still other annotational contexts in bacteria, notably YitW, N-6 adenine-specific DNA methylase, and rhamnose reductase-related protein. A peculiar practise in structural genomics programs -- selecting targets at random, posting structures to PDB, never bothering with an article -- results in orphaned, uncharacterized entries such as 3LNO Bacillus anthracis and 3CQ1 Thermus thermophilus in the case of DUF59. In addition, neither GenBank nor UniProt entry annotation tracks propagation -- for example, it is utterly unclear who, why or where a protein in an unknown species was initially designated YitW.

While partly attributable to unsatisfactory computer annotation and nomenclatural multiplicities, other specific targeting systems may occur in these homologs. However when the DUF59 does not consistently reside in a overtly relevant operon, it is difficult to distinguish specific from general targeting. Starting with a given DUF59, it is far from clear where its natural blastp cluster group begins and ends, given potentially rapid rates of sequence divergence in prokaryotes.

These alternatives are additionally difficult to resolve because potential Fe-S apo-protein targets associated to DUF59 modification may not be annotated as such, having proven notoriously difficult to detect in the case of DNA helicases, polymerases and primases. The problem arises from loss during aerobic protein purification (perhaps with replacement by Zn) and lack of reliable bioinformatic signature for iron-sulfur clusters, notably an 'insufficient' number of conserved liganding cysteines (due to cooperating dimeric sites or 19290777 glutathione contributing unsuspected cysteines), a lack of consistent pattern spacing in the cysteines, and ambiguity relative dedicated zinc binding sites.

Beginning with the Thermus thermophilus DUF59 domain with determined structure (3CQ1 Q53W28), tBlastn against complete genomes proves the most instructive approach. Here Thermus scotoductus has an unsurprising 83% identical match to the query but also a 42% match elsewhere to a second 'metal-sulfur cluster biosynthetic enzyme' (ie SufT), a 34% match within the Paa operon (ie PaaD) and a 39% hit to ATP-binding Mrp/Nbp35' suggestive of eukaryotic iron-sulfur assembly paralogs.

These matches specifically conserve ultra-conserved motifs of SufT; however the 'Nbp35' match is to a fused N-terminal DUF59 domain, very reminiscent of a similiar fused protein in Arabidopsis thaliana (Q6STH5). The bacterial Nbp35 domain aligns to NUBPL, NUBP1 and NUBP2 in human which are not fused to a DUF59 domain (ie FAM96B). Nbp35 does not have functionally related gene neighbors in either T. thermophilus or E. coli.

Beginning with the Bacillus anthracis DUF59 domain with determined structure (3LNO Q81XF6), tBlastn against compete bacterial genomes may turn up instructive operon membership in at least some species. While the gene, often called YitW is adjacent to presumably related entitites yitV and yitU, these are ordinary hydrolases unrelated to iron sulfur complexes. In other Bacillus selenitireducens, it is adjacent to a P-loop NTPase helicase, mildly suggestive of an association. In Halobacillus halophilus, it is adjacent to and transcribed in the same direction as molybotperin biosynthetic proteins MobB moaE moaD, an association often observed with DUF59 domains and one that might make sense in terms of Fe-S clusters (moaD is the sulfur carrier protein).

Crystallographic structures from the euryarchaeote Archaeoglobus fulgidus (3KB1 or 2PH1) can be used as structural template for HCF101 (and related sequences, notably human NUBP1). Percent identity at 39% is low but adequate for some purposes. The seemingly biologically illiterate Structural Genomics Consortium picked family representatives lacking Duf59 and DUF971 domains. No article or commentary accompanies the 2008 submissions. The dimer has a zinc ion at its center held together by deeply conserved pair of CPNC motifs that however are lacking in higher eukaryotes such as plants.

The Arabidopsis protein HCF101 is a triple fusion of a DUF59 domain, a P-loop ATpase resembling human NUBPL somewhat more than NUBP1 (NBP35) or NUBP2 (CFD1), and a DUF971 domain (a free-standing protein of unknown function in bacteria). The triple fusion did not arise in plants -- it is already found in early diverging eukaryotes (stramenopiles and alveolata). Since both bacteria and archaea (euryarchaeotes and thaumarchaeotes but not crenarchaeotes which have only standalone NUBP1 eg YP_004781840) have the DUF59-NUBPL fusion, the initial double fusion is ancient. Fungi and metazoans have no DUF59-NUBPL fusion proteins though Duf971 is not altogether lost (eg two Fe dioxygenases BBOX1 TMLHE in human). Frog and hydra have odd fusions accessions, possibly processed pseudogene fusions: XP_002945459, XP_002161498.

Despite some evidence to the contrary, the HCF101 gene family cannot bind a 4Fe-4S cluster via four conserved cysteines as none such exist, according to the broader set of orthologs available today. One conserved cysteine is taken up by the DUF59 domain and another by the P-loop itself; the only other candidate C..C seen in prokaryotes and some early diverging eukaryotes, does not extend to plants.

The best structural template for the triple fusion protein DUF59-NBP35-DUF971 (Arabidopsis HCF101 or unfused human NUBP1) is the DUF59 structure 3KB1 of the euryarchaeote Archaeoglobus fulgidus. Percent identity is low at 40% but adequate for some purposes. Note DUF971 is a free-standing protein of unknown function in bacteria.

The triple fusion of HCF101 did not arise in plants -- it is already present in early diverging eukaryotes (stramenopiles and alveolata) which lack chloroplasts (the intra-cellular location of HCF101). The double fusion DUF59-NUBPL too is older, occurring in both bacteria and archaea. Fungi and metazoans lack DUF59-NUBPL and NUBPL-DUF971 fusion proteins though Duf971 is not altogether lost (eg human Fe dioxygenases BBOX1 and TMLHE).

The Archaeoglobus protein is also a dimer with a central zinc ion held by a deeply conserved pair of CpnC motifs in the NUBPL that however are not available in Arabidopsis HCF101 which has one conserved cysteine taken up by the DUF59 active site and another by the ATP-binding P-loop and so lacks conserved cysteines or histidines at homologous position to CpnC.

However alignment of archaeal protein with the triple paralog system in humans shows remarkable conservation in this region, so the dimer may well bind a 4Fe-4S cluster as that paper concluded. Plants including Arabidopsis do have a second standalone NUBPL counterpart with the CpnC motif so that is probably the proper comparison here, with HCF101 representing a loss in certain early diverging eukaryotes though not all (eg the Paramecium triple fusion).

NUBP2_homSap   ENMSGFtCPHCtECtsvF (consensus of 46
NUBP1_homSap   ENMSGFiCPKCKKESQIF
NUBPL_homSap   QNMSVFQCPKCKHKTHIF
archaeal 3KB1  ENMAYFECPNCGERTYLF
Arabidopsis    ENMCHFDAD--GKRYYPF HCF101  
Arabidopsis    ENMSCFVCPHCNEPSFIF NP_193689 chromosome partitioning
               ENMSCFKCSKCGEKSYIF Zea mays NP_001150831
               ENMSCFKCPKCGEKSYIF Oryza sativa EEC75781
               ENMSHHTCSKCGHVERIF Volvox carteri XP_002954172
               ENMSYFKCPNCGERSHIF Physcomitrella patens XP_001755735
               ENMSCFKCPNCGHPSYIF Vitis vinifera XP_002282449
               ENMAYHRCGKCGHVEHIF Chlamydomonas reinhardtii XP_001702721
               ENMSFFKCPHCGEPSFIF Populus trichocarpa XP_002307635

The metazoans DUF59 domains FAM96B and FAM96A do not particularly resemble the DUF59 domain found in these fusion proteins (whose consensus sequence matches unfused YitW type best, then SufT). FAM96B occurs separately from DUF59-NUBPL-Duf971 in early eukaryotes and plants. Thus FAM96B did not arise from a breakup of the fusion protein after plant divergence; however NUBPL may have. If so, the gene duplication FAM96A appeared about the same time that free-standing NUBPL first arose and conceivably compensated for loss of the fused DUF59 domain.

Finally the remaining DUF59 domain of interest for annotation transfer is Thermotoga maritima (Q9WYV7 1WCJ) which despite two published articles provides no gene association clues to its function or target apo-proteins. However the String association tool provides some interesting suggestions:

DUF59string.png


Alignment of FAM96A and FAM96B in phylogenetic order:

FAM96A_homSap   --EKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD
FAM96A_calJac   --EKALEVYDLIRTIRDPEKPSTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD
FAM96A_otoGar   --EKALEIYDLIRTIRDPEKPNTLEELEVVTESCVEVQEINEEDYLVIIKFTPTVPHCSLATLIGLCLRVKLQRCFPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD
FAM96A_tupBel   --EKALEVYDLIRTIRDPEKPNTLEELDVVTESCVEVQEINEDDYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD
FAM96A_musMus   --EKALEVYDLIRTIRDPEKPNTLEELEVVTESCVEVQEINEDDYLVIIKFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD
FAM96A_oryCun   --EKALEVYDLIRTIRDPEKPNTLEELEVVTESCVEVQEINEDDYLVVIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD
FAM96A_bosTau   --EKALEVYDLIRTIRDPEKPNTLEELEVVTESCVEVQEINEDDYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD
FAM96A_canFam   --EKALEVYDLIRTIRDPEKPNTLEELEVVTESSVEVQEINEEDYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD
FAM96A_loxAfr   --EKALEVYDLIRNIRDPEKPNTLEELEVVTESCVEVQEINEDDYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD
FAM96A_choHof   --EKALEVYDLIKIIQDPEKPNTLEEPEVATESCVEVQEINEEDYLVII-FTPTVPHCCLATLIGLCLRVKLQRCLPFKHNLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD
FAM96A_monDom   --EKALEVYDIIRTIRDPEKPNTLEELEVVTESCVEVKEIHEEDYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVIEPD
FAM96A_ornAna   --DKALEVYDLIRTIRDPEKPNTLEELEVVTESCVKVKEVDEDDYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD
FAM96A_taeGut   --DRAIEVYDIIRTIRDPEKPNTLEELEVVTENCVQVQEIGEDEYLVIIRFTPTVPHCSLATLIGLCLRIKLQRCLPFRHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVTEPD
FAM96A_galgal   --DKALEVYDIIRTIRDPEKPNTLEELDVVTESCVQVDEIGEEEYLVVIRFTPTVPHCSLATLIGLCLRIKLQRCLPFRHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVTEPD
FAM96A_chrPic   --DRALEVYDIIRTIRDPEKPNTLEELEVVTESCVEVHEIGEDEYLVIIRFTPTVPHCSLATLIGLCLRIKLQRCLPFKHKLEIYISEGAHSTEEDVNKQINDKERVAAAMENPNLREIVEQCVTEPD
FAM96A_anoCar   --ERALEVYDIIRTIRDPEKPNTLEELDVVTESCVEVHETSEDEYLVTIRFTPTVPHCSLATLIGLCLRIKLQRCLPFKHKLEIFISEGAHSIEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD
FAM96A_xenTro   --ERALEVYDIIRNIRDPEKPNTLEDLDVVSESCVSVQELDEECYLVVIRFTPTVPHCSLATLIGLCLRVKLQRCLSFKHKLEIYISEGTHSTEEDINKQINDKERVSAAMENPNLREIVEQCVTEPD
FAM96A_danRef   --EKALEVYDVIRTIRDPEKPNTLEELDVVTEKCVEVQELGDDEYLIVIKFSPTVPHCSLATLIGLCLQVKLQRCLPFKHKLEIYITEGTHSIEEDINKQINDKERVAAAMENPNLREIVEQCVTEPD
FAM96A_oreNil   --EKALEVYDVIKSIRDPEKPNTLEELEVVTEKCVEVQELGEDEYLIIIRFSPTVPHCSLATLIGLCLQVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVTEPD
FAM96A_oryLat   --EKALEVYDVIRSIRDPEKPNTLEELEVVTEKCVEVQDLGEDEYLIIIKFSPTVPHCSLATLIGLCLQVKLQRCLPFKHKLEIYLSEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVTEPD
FAM96A_cioInt   MEDYEGTIYDIIRTIKDPEKPGSLEDLDVVYEEGVSVKTSENHRCNVEVKFRPTIKHCSLATLIGLCLHVKLQRTLPTTHKIRVFVKEGSHNTEDEVNKQINDKERIAAAMENPNIRKMVENCIKEPD
FAM96A_braFlo   LDDLSDIVYDLIRDIRDPEKDNTLEELDVVYESGVHVEPWGEDKFHISIEFTPTVPHCSLATLIGLCLRVKLENNLPQHYKLDITVKEGTHSTGPEINKQINDKERIAAAMENPDLRAVVNKCVQDPE
FAM96A_sacKow   EKELAEEIYDIIRTIRDPEKPQTLEDLDVVYEDGVLVNHRGTDEFLVNVEFTPTVPHCTLATLIGLCIRVKLQRTLPHSYKLDIFIKKGTHSTEDEINKQINDKERIAAAMENPNLKDLVDNCVVDLE
FAM96A_strPur   LNGMAGDIYDIIRDIQDPEKPNTLEDLEVVYEEGVTVAALETEEQLINIEFTPTVPHCSLATLIGLCLRVRLERSLPNKHKLDIIVKKGTHATEDDINKQINDKERIAAAMENPNLRKLVEHCVSIED
FAM96A_triCas   DSELKYTVYDLIRTIKDPEKPNTLEELNVVYEEGVEVKERTSGNVSVVVEFNPTVPHCSLATLIGLCIRIKLERCIPYRIKLDIYIKAGAHTTEHEINKQINDKERIAAAMENPNLREMVENCIVEED
FAM96A_nemVec   NRNLALDVYDLIKDIKDPEKPQTLEDLKVVYESCVEVQKVAGQDHIT-ITFTPTVPHCSLATLIGLCIRVKLEKSLPEKFKLDIYLKKGTHSTENEINKQINDKERIAAAMENPNLRKIVENCIDEDN
FAM96A_acrPal   NLVLVQEVFDIVKDIRDPELPQTLEELHVIEEEFIKIDKIENDEYIIKIEFTPTVPHCSLATLIGLCLRVKLERSLPYKFKLDIFLSRGTHSTENEINKQINDKERIAAAMENPNLKKIVEECILDAN
FAM96A_triAdh   NQKLCSQIFELIRDIKDPELPQTLEELNVVTEDEIFVRNMKQGEACIRINFTPTVPHCSLATLIGLCIRVKLQRCLDQDYKLDIYVTKGSHDTEDGVNKQINDKERVAAAIENPNVKKLVEECLQEVQ

FAM96B_homSap   DSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRVQV---SDPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKERVAAALENTHLLEVVNQCLSARS
FAM96B_papHam   DSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRVQV---SDPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKERVAAALENTHLLEVVNQCLSARP
FAM96B_micMur   DSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRVQV---SDPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKERVAAALENTHLLEVVNQCLSARS
FAM96B_tupBel   DSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRVQV---SDPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKERVAAALENTHLLEVVNQCLSARS
FAM96B_musMus   DSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRIQV---SDPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKERVAAALENTHLLEVVNQCLSars
FAM96B_oryCun   DSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRVQV---SDPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKERVAAALENTHLLEVVNQCLSARS
FAM96B_bosTau   DSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRVQV---SDPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKERVAAALENTHLLEVVNQCLSARS
FAM96B_canFam   DSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRVQV---SDPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAGKKQLADKERVAPPLENTHLLEVVNQCLSARS
FAM96B_loxAfr   DSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRVQV---SDPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKERVAAALENTHLLEVVNQCLSARS
FAM96B_choHof   DSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRVQV---SDPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKERVAAALENTHLLEVVNQCLSARS
FAM96B_macEug   DSIDDREIFGLIRSINDPEHPLTLEELNVVEQVRVKV---NDRESTVAVEFTPTIPHCSMATLIGLSIKVKLIRSLPERFKMDVHITPGTHASEHAVNKQLADKERVAAALENSHLLEVVNQCLSARS
FAM96B_monDom   DSIDDREIFVLIRSINDPEHPLTLEELNVVEQVRVKV---NDRESTVAVEFTPTIPHCSMATLIGLSIKVKLIRSLPERFKMDVHITPGTHASEHAVNKQLADKERVAAALENSHLLEVVNQCLSARS
FAM96B_galGal   DSIDDREIFDLIRSINDPEHPLTLEELNVVEQVRVKV---NDAESTVAVEFTPTIPHCSMATLIGLSIKVKLIRSLPERFKMDVHITPGTHASEHAVNKQLADKERVAAALENSHLLEVVNQCLSARS
FAM96B_xenTro   DRIDDREIFDLIRCINDPEHPLTLEELNVVEEIRVKV---SDEESTVSVEFTPTIPHCSMATLIGLSIKVKLLRSLPERFKVDVHITPGTHASEHAVNKQLADKERVAAALENSHLLEVVNQCLSGRS
FAM96B_tetNig   DPIDDREIFDLIRTINDPEHPLSLEELNVVEQVRVKV---NDAESTVDVEFTPTIPHCSMATLIGLSIKVKLLRCLPNRFKIDVHITPGTHASEEAVNKQLADKERVAAALENSSLLEVVNQCLSSRG
FAM96B_gasAcu   DPIDDREIFDLIRAINDPEHPLSLEELNVVEQVRVQV---NDEESIVGIEFTPTIPHCSMATLIGLSIKVKLLRSLPDRFKIDVHITPGTHASEEAVNKQLADKERVAAALENSSLLEVVNQLTPTRG
FAM96B_danRer   DPIDVREIFDLIRSINDPEHPLSLEELNVVEQVRVNV---NDEESTVSVEFTPTIPHCSMATLIGLSIKVKLLRSLPDRFKIDVHITPGTHASEDAVNKQLADKERVAAALENSQLLEVVNQCLSSRG
FAM96B_petMar   DEIDSREVFDLIRGINDPEHPLTLEELKVVEEAYVSV---TDAESMVVVAFTPTIPHCSMATLIGLAIRVQLLRCLPDRFKVDVHIAPGMHASEHAVNKQLADKERVAAALENSHLLGVVNQCLGGRK
FAM96B_cioInt   DPFDRREIFDLIRDINDPEHPLTLEDLRVVSENDIEV---DDEKSFIKVSFTPTIPHCSMATLIGLAIRVRLLRSLPPRFKVEVEISPGSHQSEKAVNKQLGDKERVAAALENNHLLNVVNQCLTgrk
FAM96B_braFlo   DAIDAREIFDILSSINDPEHPLTLEELNVIEQSRITV---DEDNNHVSVEFTPTIPHCSMATLIGLSIRVKLLRALPTRFKVDVHITPGTHQSEHAVNKQLADKERVAAALENQHLLEVVNQCLSTRN
FAM96B_strPur   DAIDTREVFDLIRNINDPEHPLTLEELNVVQQAEVEV---DDPGNVVKVTFTPTIPHCSMATLIGLAIRVKLIRSLPSRFKVDINIKPGTHVSENAVNKQLADKERVAAALENNHLLEVVNQCLTQRD
FAM96B_monFav   DKIDEREVFDLIRSINDPEHPLTLEQLNVVEQSLVEV---DDTNNYVKIQFTPTIPHCSMATLIGLAIRVQLLRSLPDRFKVDISITPGTHASEDAVNKQLADKERVAAALENTHLLEVVNQCLAVRH
FAM96B_nemVec   DKIDDREIFDMIRSINDPEHPLTLEELNVVEQALIDV---SDDESYVKVQFTPTIPHCSMATLIGLAIRVRLLRSLPDRFKVDVKITPGTHQSEIAVNKQLADKERVAAALENNHLLDVIDQCLVSKK
FAM96B_plePil   dkiddreivdmirsINDPEHPNSLEELSVVQLDLITC---NDTDNYVDVKFTPTIPHCSMATLIGLSLKVKLLRSLASRFKVDVRITPGSHSTEEAINKQLADKERVAAALENPQLVNMVNQCIYGkk
FAM96B_ampQue   DEIDAREVFDLIRHINDPEHPLTLEELNVVQEDLICI---NNKENFVSVHFTPTIPHCSMATLIGLSIRVCLLRSLPNRFKIDVIITPGSHMSEQAINKQLADKERIAAAIENSHLLNVVHQCLNTKR
FAM96B_subDom   DEIDAREVFDLVKNINDPEHPLTLEQLNVVQLGHIDV---SDVDSSVTVYFTPTIPHCSMATLIGLSIRVRLLRALPARFKVDVMISPGTHASEVAVNKQLADKERIAAALENNHLLDVVNSCLTGVr
FAM96B_triAdh   DKIDEREIFDIIRSINDPEHPLTLEELNVVEECKIDV---DDDNNFVKVHFTPTIPHCSMATLIGLCIRVRLIRSLPERFKVDITVTPGSHSSEIAVNKQLADKERVAAAMENSNLLKVVNQCLAMDr
FAM96B_monBre   DPFDSREIFDLVRHINDPEHPLTLEELNVVRLDQILV---DDAQNYVRVQFTPTIPHCSMASLIGLCLRVRLLRALPPRFKVDVEIFPGTHATEASINKQLADKERVAAALENPNLKTVVNECLQLDD

FAM96B_sacCer   DLIDAQEIYDLIAHISDPEHPLSLGQLSVVNLEDIDVHDSGNQNAEVVIKITPTITHCSLATLIGLGIRVRLERSLPPRFRITILLKKGTHDSENQVNKQLNDKERVAAACENEQLLGVVSKMLVTCK
FAM96B_ajeDer   EPIDEQEIYDLIATIADPEHPISLGALAVVSLPDISIKPPDSPLRTVSVLITPTITHCSLATVIGLGVRVRLEQSLPPRFRVDVRIKEGTHSTADEVNKQLADKERVAAALENGTLMGVIGKMLETCQ
FAM96B_ashGos   DPVDPQEIYDLIAHISDPEHPLTLGQLAVVNLPDIEVRDSGDPHAEVVVRITPTITHCSLATLIGLGIRVRLERSLTPRFRITVLLKKGSHQSENQVNKQLNDKERVAAACENEQLVEVVSKMLSTCK
FAM96B_canAlb   DPIDEQEIFDLIATISDPEHPLTLAQLAVVNLSDIKITNDGGGGSEVLIKITPTITHCSLATLIGLGIRVRLDRSLPSRYRIKILIKEGTHQSENQVNKQLNDKERVAAACENDQLLNVISQMLSTCK
FAM96B_dekBru   EPIDAQEIYDLTASISDPEHPLTLGQLAVXNLNDIEVKNASDKSGEILLRITPTISQCSLATLIGLGIRVRLDRCLPKRFRITILLKEGTHQTEKQVNKQLNDKERVSAAAENPQLLKVISNMLSSCE
FAM96B_kluLac   DPIDAQEIYDLIAHISDPEHPLTLGQLAVVNLADIEVHDTNGKDAEVIVRITPTITHCSLATLIGLGIRVRLERSLSPRFRITILLKKGTHQSENQVNKQLNDKERVAAACENDQLLGVVSKMLSTCK
FAM96B_komPas   ESVDALEIYDLISSISDPEHPLTLGQLAVVNLEDIQLDDSGNPNAEVIIKITPTITHCSLATLIGLGIRVRLERCLPPRYRIIIKVKEKTHQSENQVNKQLNDKERVSAACENDQLLKVISQMLSSCK
FAM96B_parBra   EPIDEQEIFDLISTIADPEHPISLGSLAVVSLPDISIRPPDSPLRTVTVLITPTITHCSLATVIGLGVRVRLEQSLPHRFRVDVRIKEGTHSTADEVNKQLADKERVAAALENGTLMGVIGRMLETCQ
FAM96B_schPom   DPIDPQEIYDLLAKINDPEHPLTLAQLSVVKLEDIEVVDNVEGDSYITVHITPTIPHCSMCTLIGLCIRVRLERCLPPRFHVDVKVKKGTHASESQVNKQLNDKERVAAACENEQLLSVLNGMMATCV
FAM96B_triAtr   EAIDEQEIYDLISNITDPEHPVSLGQLSVINLPDIHITPVPSPNVQVTVELTPTVTHCSLATVLGLGVRVRLEQVLPPNYRVEVICKENSHSQDDQVNKQLSDKERVAAALENDSLKSVLDKMLESCI
FAM96B_yarLip   EPIDSQEIYDLIATISDPEHPLTLGQLAVVKLEDIWVHDTGDKNAEIVVKITPTITHCSLATLIGLGIRVRLERALPPRFRFTITVKEGTHQSENQVNKQLNDKERVAAACENEQLLGVISGMLATCQ

FAM96B_micSpp   DPVDAIEVFYHIKNINDPEHPYSLEQLDIVSVENIRV---HSEAQFIQVYFTPTVPHCSMATLIGLAIRRKLQESLAGRFKTEVLVFPGSHSSESAVNKQLNDKERVAAALENTNLLEKVNLCLRGNL
FAM96B_ostLuc   DAVDALEIFDHVRDINDPEHPYSLERLNVVGASAIEC---DDARNRVRVEFTPTVPHCSMATLIGLSIRVKLLRTLPRRFKVDVVIAPGTHASERAVNKQLNDKERVAAALENGNLLEKVDLCLSGKT
FAM96B_araTha   EPIDQLEIFDHIRDIKDPEHPNTLEDLRVVTEDSVEV---DDENSYVRVTFTPTVEHCSMATVIGLCVRVKLLRSLPSRYKIDIRVAPGSHATEDALNKQLNDKERVAAALENPNLVEMVDECLPSEE
FAM96B_vitVin   EPVDQQEIFDHIRDIKDPEHPYSLEELKVITEDAIEV---DDKRSYVRVTFTPTVEHCSMATVIGLCLRVKLLRSLPSRYKVDIKVAPGTHATEAAVNKQLNDKERVAAALENPNLLDMVDECLAPSY
FAM96B_popTri   EPIDQLEVFDHIRDIKDPEHPYSLEELKVITEDAIEV---DDNHSYVRVTFTPTVEHCSMATVIGLCLRVKLMRSLPQRYKVDIRVAPGTHATESAVNKQLNDKERVAAALENPNLVDMVDECLAPSY
FAM96B_zeaMay   EPIDQLEIFDHIRDIKDPEHPYSLEQLNVVTEDSIEL---NDESNYVRVTFTPTVEHCSMATIIGLCIRVKLVRSLPPRYKVDIRVAPGSHATEAAVNKQLNDKERVAAALENPNLLDMVEECLSPTF
FAM96B_braDis   EPIDQLEIFDHIRDIKDPEHPYSLEELNVVTEESVEI---NDKLSHVRVTFTPTVEHCSMATVIGLCVRVKLIRSLPPRYKVDIRVAPGSHATETAVNKQLNDKERVAAALENPNLLDIVEECLAPTF

FAM96B_dicDis   DEFDEQEIFDLVRSITDPEHPLTLEQLNVVRIENVNI---NLENSYILLYFTPTVPHCSMANLIGLSIKEKLARSLPKRFKVDVIVTPGSHSSESSVNKQLNDKERVSAALDSSSILTIVNECIKQN-
FAM96B_polPal   DDFDVYEIFDLVRDINDPEHPLTLEQLNVVRHENIKI---DISNNIIRLYFTPTVPHCSMANIIGLSIKEKLSRSLPQRFKVDVKVTPGSHSSEQSVNKQLNDKERVSAALDSSSILNVVNECIKLPI
FAM96B_entDis   EDIDQLEIYEHIRRIKDPEHPVTLEQLKVISPDLINV---DDKGNHIIVKFTPTVDNCTMATLIGLTIRTKLMRILPPRIKLDIYLTKGTHQTEEDVNKQLNDKERIAAALEKQTLLQLVNKCLIlpi
FAM96B_phyInf   DPFEPDEVFEILRHINDPEHPLTLEQLKVMSLENVHV---DDVNSRVKIFFTPTIPHCSMATLIGLCLRVKLLRSLPSRFKVDILITPGTHSSEAAVNKQLNDKERVAAALENSHLLTVVNKCIAHTD
FAM96B_thaPse   DAITVNEIFDIVRNIQDPEHPLTLEQLNVVRLELIKV---VDSFSTVHVQFTPTIPHCSMATLIGLSLRVKLLRSLPPRFKVVVEIESGTHASEHAVNKQLADKERVRAALENEHLLGVVNKCIAGVA
FAM96B_phaTri   DMVDADEVFEIIRNIQDPEHPLTLEQLGVVSKRQIDV---HDSYSTLDVRFTPTIPHCSMATHIGLCLRVKLDRSLPPRFKVKVRIEPGSHSSETAINKQLADKERVCAALENKHLLGIVNRCIIDGM
FAM96B_naeGru   DEFDALEVYDLIRNINDPEHPLSLEQLKVTQHDLITV---DNKNNLIVIYFTPTITHCSMATLIGLSIRVKLLRSLPKRFKVDIFITPGTHQSEDQVNKQLNDKERVAAALENERLLSVVNRCIAQS-
FAM96B_triVag   EAIDSLELYNYIRLIKDPEHPFSLEQLHIVSPDDIKV---DDKEGRVNLVFTPTVPNCSLPAVLGLCIRERLLQVLPQRFKIFITVARGKHIQEDSINRQLRDKERCLAALERRNIRTMIDNCIACDD
FAM96B_cryMur   SEITPMDIFEIIRRIKDPEYPLTLEQLNVVELKNISV---DNNANRVIVYFTPTITSCSQASLIGLSILFKLTFTLPSRFKVIIKVTPGSYDSEEALNKQMRDKERVRAALENMQIFKAITRGIVNSD
FAM96B_babBov   DEFEVTEIFNIIRNIKDPEYSYTLESLKIVEPENIDI---DQENAIVTVKFTPTVPHCSQATIIGLMIYVKLQQSLPLHFKIDVQITEGTHNTEDAINKQLLDKERVAAALENPVLLDMINDGIYNTV
FAM96B_tetThe   DEIDQLEIFDLIRHIDDPEHPLTLEQLNVLQPENIKV---NIDHKLVTVLFTPTIPHCSLAQIIGLMIKVKLIRSLPRDYKVDVYITPGTHVQELSVNKQINDKERVMAAIENPSILRVVNKGVSNSD
FAM96B_theAnn   ESFDEEEIFDIIRTIKDPEYSYSLEDLNVVSKDNIFI---DEDTSTISVFFTPTVPHCTQASIIGLMIFVKLYQSLPPYFKIDVQISKGTHNTEEMINKQLLDKERISAALEYPPILKMINKGILFLQ
FAM96B_tryCru   DPIDSLEVFHHIRSIRDPEHPNTLEELKVVEPELIRV---DEVKQTVRVQFTPTVPHCSMTTLIGLCISLKLQRSLPRGTKVDVYVTPGSHEQEEQVNKQLNDKERVAAALENKNLLNVVESCLNEFE
FAM96B_leiInf   DPIDAWEVFEIIRRIRDPEHPNSLEQLKVVEPSLITV---DWKKRHIRVLFTPTVPHCSLTTLIGLSIRLQLERSLPEYTKVDIYVTPGTHEQEAQVNKQLNDKERVAAALENCNLLNVVESCINEFD
Alignment of bacterial SufT proteins:
                                                                  *
SufT_ralEut -EPDSLEGRVIAALRTVYDPEIPVNIYDLGLIYQLSVDEASGKVGIRMTLTAPGCPVAQTFPGVVESAVMEASGVDAVEVELVWDPPWSRERMSEAARLELGLL Ralstonia eutropha
SufT_burTer -TTERLEVRVIDALRTVFDPEIPVNIYDLGLVYGLDVDQAEGRVEIRMTLTAPGCPVAQTFPATVEDAVFCVCGVNEVHVELVWDPPWSRERMSDAARLQLGML Burkholderia terrae 
SufT_azoSpp -EGEGLRDEVVAVLRLIYDPEIPVNIYDLGLIYGLDIDEAKGKVDIRMTLTAPACPVAESLVSSVKEAVASVDGVEDAAVELVWDPPWTQDRMSEAARLDLGLL Azoarcus spp. 
SufT_pseFer -PVSELQQRVIEALRTVYDPEIPVNIYDLGLVYALDVDDAEGKVRIDLTLTAPGCPVAQTFPALVAEAVERVDGVHEAEVELVWEPPWSQDMMSEAARLELGLL Pseudogulbenkiania ferrooxidans 
SufT_polSpp -PVTGLQARVIEALRGVFDPEIPVNIYDLGLVYGLDVDEALGKVHIRLTLTAPGCPVAQTFPEVVGSTVDGVPGVNEVEVELVWQPPWSKGMMSEAARLQLGLL Polaromonas spp. 
SufT_legLon -DSELLKEAIINALRGVYDPEIPVNIYDLGLIYDVSIDD-NAHVLIQMTLTTPGCPVAQTFPGTVEQAVNQVEGVSDCTVELVWEPPWSQERMTEAARLELGIF Legionella longbeachae 
SufT_metSpp -TAEDLKEDVIEMLKTIYDPEIPVNIYELGLIYQIDVSD-SGNVVIQMTLTAPGCPVAQTFPGDVENKIRSIDGVNKVHVELVWDPPWTRDQMSEAAQLQLGMF Methylophaga spp. 
SufT_fluDum -DAELLKEAIVNALREIYDPEIPVNIYDLGLIYDISIDD-ESHVTIQMTLTTPGCPVAQTFPGTVEQAVNKVEGVCDCTVELVWEPPWSQERMTEAARLELGMF Fluoribacter dumoffii 
SufT_ricGry -NEATLKNSIVNTLKHIYDPEIPVNIYDLGLIYHIFIDV-PGHVTIQMTLTTPGCPVAQTFPSMVENAVNAIDGVHETQVELVWDPPWTSAKMSEAAKLQLGML Rickettsiella grylli 
SufT_metMob -SREALLVRVKEMLQTIYDPELPVNIYDLGLVYKLEATE-SGQVSIEMTLTTPNCPVAQTFPDTVREKLLCVPGVSSVGVTLVWDPPWGRDSMSEAAKLQLGML Methylotenera mobilis 
SufT_pedHep -DKEALKQKVIDCLQTIYDPEIPVNIYELGLIYETEILPPLNNVQIVMTLTAPGCPAAQSIPLEVEQKVKEIDGINEVTVEVTWDPPWNRDMMSETARLELGMM Pedobacter heparinus 
SufT_allVin MDPEELREPIIASLRGVHDPEIPVNIYDLGLIYRIDIAG-NGDVSVDMTLTAPGCPVAGMMPLMVKSAVERVEGVGQVSVQLVWDPPWSADNMSDEARLQLGLM Allochromatium vinosum 
SufT_marPur VDVEALRESIVTALRGVHDPEIPVNIYDLGLIYTIDIAA-DGTVAVEMTLTAPGCPVAGMMPLMVKQAVARVEGVGEVDVALVWDPPWTQERMSDEARLQLGLM Marichromatium purpuratum 
SufT_nitMob VGGERLREAVVEALQCVYDPEIPINIYALGLIYELDVND-EGFVDVVMTLTSPSCPVAGQMPGMVKSAVEQVAGVRAAEVELTWDPPWSSDRVSEAGKLQLGLI Nitrococcus mobilis 
SufT_tisMob DDPGDLEAAVIDVLRSCYDPEIPVNIYDLGLIYEVRIDA-GDQAYIRMTLTSPMCPVAESLPVEIETKIRDIAGISDVTVEVVWDPPWTPEMMSEDARLELNMF Tistrella mobilis 
SufT_thiVio MEAEELREPIIAALRGVHDPEIPVNIYDLGLIYSVDIAP-NGDVAIDMTLTAPACPVAGMMPIMVKDAVSRVDGVGEVRVELVWDPPWGQENMSDEARLQLGLM Thiocystis violascens 
SufT_ignAlb ISKQELEEKIIQALKTCYDPEIPVDIFELGLIYEVAI-DDNNNVKIKMTLTSPMCPAAQSLPLEVEGKVKSIPQVNDVKVEVVWNPPWNKDMMSEVAKLELGFL Ignavibacterium album 
SufT_anaThe KEFLNIESDIVKVLKTVYDPEIPVNIYDLGLIYEIEVRDE-GKVKIVMTLTSPNCPVAESLPEEVYEKVLAVDGVNDVELHLTFDPPWSKDMLSEEAMLELGLL Anaerophaga thermohalophila 
SufT_zymMob PDKEKLKAEIIETLRDIYDPEIPVNIYDLGLIYDIEIGD-DNHVVIKMTLTTPNCPVAGSMPAEIELRVGQIKGVGAVEVELVWDPPWGMDRISDEAKLELGLL Zymomonas mobilis 
SufT_thiDre VDAEALREPIIAALRMVHDPEIPINIYDLGLIYRIDIAG-DGDVKVDMTLTAPACPVAGMMPLMVRDAVARVEGVGEVQVELVWDPPWNQNNMSDEARLQLGLM Thiorhodococcus drewsii 
SufT_erySpp GAGSDLQQAVIDALKEIYDPEIPVNIYDLGLIYGVEVDD-EADATITMTLTTPHCPVAETMPGEVELRAASVPGIRDAEVELVWDPPWSPEKMSDEARLELGML Erythrobacter spp. 
SufT_rosNub STDHPLYDGVVEACRTVYDPEIPVNIYDLGLIYTIDIDD-ESAVKIIMTLTAPGCPVAGEMPGWVAEAIEPMAGVKQVDVELTWEPPWGMEMMSDEARLELGFM Roseovarius nubinhibens 
SufT_rosSpp STDHPLYDQLVEACRTVYDPEIPVNIYDLGLIYTIEIDA-ENAVRVIMTLTAPGCPVAGEMPGWVAEAIEPVAGVKQVDVELVWDPPWGMDMMSDEARLELGFM Roseobacter spp. 
SufT_sphAla AVGGDLYEAVIAALKDIYDPEIPVNIYDLGLIYNVEID--EGHVMVTMTLTTPHCPVAESMPGEVELRVGAVPGVGDAEVNLVWDPPWSPANMSDEARLELGML Sphingopyxis alaskensis 
SufT_braSpp ADKDALVTEIVAALRTVHDPEIPVNIYDLGLIYRIEPKD-DGQVDIDMTLTAPGCPVAGEILTWVETAVRAIDGIAGVEVRLVFDPPWDSSRMSDDVKLELGLL Bradyrhizobium spp. 
SufT_pheZuc AELDRLTDQLIEKLKTVYDPEIPVDIYELGLIYKVDVSD-DKDVAIDMTLTAPGCPVAGEMPGWVEDAVMEIDDIKSCKVELVFDPPWDPSRMSDEAKLQLNMF Phenylobacterium zucineum 
SufT_thiSpp MDAEELREPIIAALRRVHDPEIPVNIYDLGLIYKIDIAS-NGNVDVDMTLTAAACPVAGMMPLMVKDAVQKVEGVGQVEVELVWDPPWSQDNMSEEALLQLGMM Thiorhodovibrio spp. 
SufT_rhoBac TTDHPLYENVVEACRSVYDPEIPVNIYDLGLIYTIEIDA-ESDVAIKMSLTAPGCPVAGEMPGWVAEAVEPLPGVKTVAVELVWEPPWGMEMMSDEARLELGFM Rhodobacterales bacterium 
SufT_salRub TPDDDLYQRVVESLREIYDPEIPVNIYDLGLIYHLDVGE-DSHVDVLMTLTAPNCPAAGVLPGQAEDAVRETEGVESVNLEMTFEPPFSPQMMSEEARLELGFM Salinibacter ruber 
SufT_azoAma DGDPALMAAVFEALRTVRDPEIPVNLVDLGLIYRVRVHR-DGLVHIDMTLTTPACPVATTLPGQVQNLVSLVPGVSVVLVDMVWDPPWTRDRMTESARLELGLV Azospirillum amazonense 
SufT_cycMar DDQEALKGKVINAIKDVYDPEIPVDVYELGLIYEITVYPV-NNVYILMTLTSPNCPAAESIPSEVKESVGNIEGVNNVEVELTFDPPYSQDMMSEVAKLELGFL Cyclobacterium marinum 
SufT_rhoMar LGDKELEQAIIEALKSVYDPEIPVNIYDLGLIYEIRIFE-DRTVYVKMTLTAPGCPVAGTLPGQVEMRLQEVPGVKDARVELTFDPPYTIERMSDEARLALGWM Rhodothermus marinus 
SufT_niaSol MEPDTIEEKVIKELQTVFDPELPVNIYELGLIYKVEVLND-NYVKILMTLTAPSCPAAQSLPVEVDQKIRAIEGVSDVDVTITWDPAWNKSMMSEAAQLELGFL Niabella soli 
SufT_xanAut EDEAALMEAIIAGLRTVTDPEIPVNIYDLGLIYRIELKD-DGVVEIDMTLTAPGCPVAGQMLGWVQQAVGVVEGVSDVKMKLVFDPPWDKSRMSDEVQLELGLI Xanthobacter autotrophicus 
SufT_cauCre DELNRLTDQLIEKLKTVYDPEIPVDIYELGLIYKVDVSD-SKDVAIDMTLTAPGCPVAGEMPGWVKDAVMEIPGLKSCTVELTFDPPWDASRMSDEAKLQLNMF Caulobacter crescentus 
SufT_cytHut IDQAELKNKALEAIQTVYDPEIPVNIFELGLIYEVSVFPV-NNIFVQMTLTSPNCPAAQSMPAEVENKIKAIEGVNEVTVEITFDPTWSQEMMSDAAKLELGFM Cytophaga hutchinsonii 
SufT_ruePom SVDHDLYEPVVEACRTVYDPEIPVNIFELGLIYTVEISD-ENEVRVIMTLTAPGCPVAGEMPGWVAAAVESVPGVKSVEVEMTWDPPWGMEMMSDEARLELGFM Ruegeria pomeroyi 
SufT_jooMar IDTTALGEKIVTVLKTIYDPEIPVDIYELGLIYDVFVNED-SEVKILMTLTTPNCPVAETLPVEVEEKIKTIDDVKDAEVEITFDPPWSQDLMSEEAKLELGLL Joostella marina 
SufT_flaBac SKDVALGEQIVGVIKTIYDPEIPVDIYELGLIYDVLVNED-NEVKILMTLTSPNCPVAETLPVEVEEKVKSIDAVKDAEVEITFDPPWTQELMSEAAKLELGML Flavobacteria bacterium 
SufT_citSpp STGHPLHEALVEACRTVYDPEIPVNIYDLGLIYTIAIDD-ENAVKVIMTLTAPGCPVAGEMPGWVQEATSTVPGVRDVDVEMVFDPPWGMDMMSDEARLELGFM Citreicella spp. 
SufT_celAlg IDTAELGEKIVGVLKTIYDPEIPVDIYELGLIYDVFVNED-NEVKILMTLTSPNCPVAESLPAEVEEKVKSLDAVKDAEVEITFDPPWTQELMSEEAKLELGML Cellulophaga algicola 
SufT_gluMor EGTVPDQDAIIASIATVYDPEIPVNIYELGLIYAIDLHD-DGRVKIEMTLTAPNCPSAQELPEMVKDAVSHVPHVKNVEVEIVWDPPWDMSRMSDDARLALNMF Gluconobacter morbifer 
SufT_dyaFer MSEEDLKEEVIRAIKTVYDPEIPVDVYELGLIYDLKVFPI-NNVFVSMTLTSPSCPSAGTLPGEVEQKIREVEGVNDVSVELTFDPPYSTEMMSEEAKLELGFM Dyadobacter fermentans 
 Consensus   L !! al t!yDPEIPV#I%#LGL!Y   V ! MTLTaP CPvA P V v ! g! v Velvw#PPw MS# ArL#Lg   
 Prim.cons. sDDEALKEAVIEALRTVYDPEIPVNIYDLGLIYEIDIDDDEGhVKIDMTLTAPGCPVAGTMPGEVEEAVESVeGVKDVEVELVWDPPWSQDMMSEEARLELGML  

FAM96_conSeq       LIRSINDPEHPLTLEELNVVEESCVEVQEIDDDESLVIVRFTPTIPHCSMATLIGLCIRVKLLRSLPFRFKVDIYITPGTHSSEEAVNKQLNDKER 88 sequences
SufT_conSeq        ALRTVYDPEIPV-----NIYDLGLIYEIDIDDDEGHVKIDMTLTAPGCPVAGTMPGEVEEAVESVEGVK-DVEVELVWDPPWSQDMMSEEARLELG 42 sequences
PaaD_conSeq        LLSQVPDPEVPV----LSITDLGMVRDVEWEGD-GWVVVTFTPTYSGCPATELILGDIRQALTEA-GFT-PVHVEVQLSPAWTTDWMSEEGREKLR 21 sequences
Consensus          llr ! DPE Pv    ln! #lg !   #i#dDeg V ! fTpT pgCp a li g !r al    gf   V !e    p ws # mse# r klr                      
Alignment of Triple fusion DUF59-NUBPL-Duf971 (HCF101) proteins:

                                          <---------------------------------------DUF59----*---------------------->                                  < P-loop >
DUF59NUDuf971_araTha   ------ASSSVGESVAQTSEKDVLKALSQIIDP-DFGTDIVSCGFVKDLGINEALGEVSFRLELTTPACPVKDMFENKANEVVAALPWVKKVNVTMSAQPAK--PIF-AGQLPFGLSRISNIIAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVNPESRILEMNPE-K-KTIIP
DUF59NUDuf971_medTru   ----ASVEVGSSSISTGTAEDDVLKALSQIIDP-DFGTDIVTCGFVKDLQIDKALGEVSFRLELTTPACPIKDVFEKQANEVVAVLPWVKNVNVTMSAQPAK--PLF-AEQLPAGLQTISNIIAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADIYGPSLPTMVSSENRILEMNPE--KKTIIP
DUF59NUDuf971_ostTau   ------SMPAIYSAPDGSKESEVLSKLRRVIDP-DFGEDIVNCGFVKALVIDESAGSVLFAIELTTPACPVKAEFERQAKAFVEELDWVKRVSVTMTAQPAR--NDA-PETVE-GLRRVSHIIAVSSCKGGVGKSTTSVNLAYTLAMMGAKVGILDADVYGPSLPTMISPDVPVLEMDKE-T-GTIKP
DUF59NUDuf971_micSpp   ------SSPSITSAPDGSREADVLNALRNVIDP-DFGEDIVNCGFVKDLRVSD-AGDVTFTLELTTPACPVKEEFDRLSKQYVTALEWAKSCNVNMTAQPVT--NDM-PDAVE-GLKGVRHIIAVSSCKGGVGKSTTSVNLAYTLRMMGAKVGIFDADVFGPSLPTMTSPEQAVLQMDKE-T-GSITP
DUF59NUDuf971_thaPse   -------------------QSQILAALSVINDP-DLNADIVSLGFVQNLKIDESSNIVSLDLELTTPACPVKDLFVQQCQDIINGLAWTRGADVTLTSQPTA--AP--SDA-PLGMSQIGAVIAVSSCKGGVGKSTTAVNLAFALESLGAKVGIFDADVYGPSLPTMVTPEDDNVRFV-------IAP
DUF59NUDuf971_phaTri   ---------------------EVLSTLKSVIDP-DLGSDIVTLGFVQNLKLDGRD--VSFDVELTTPACPVKEQFQLDCQQLVQDLPWTNNIQVTMTAQPSV--QE--T-A-TLGMSQVGAVIAVSSCKGGVGKSTTAVNLAFSLQRLGATVGIFDADVYGPSLPTMITPQDDTVRFV-------VAP
DUF59NUDuf971_ectSil   YHVSMMTETTSDTPPGR--KDEVLAVLSAVMDP-DLSMDIVSLGFIKELEISGEDEVVTFDVELTTPACPVKAQFQQDCRDLVEALPWVDRAEVTMTAQPVR--DV--SDTVPTGLSKVATIIAVSSCKGGVGKSTTAVNLAFALDKQGAKVGILDADIYGPSLPTMVKPDREEVEFVGN-Q---IRP
DUF59NUDuf971_albLai   LRVQSLPSCSYSTRQNALLEMDILSKLRQVPDQLGLKSDIVTLGRVKNVQLSLQEKSVYLTLEAPNGALDVAEQWKKDSMESLRELDWIQSLHIETARPKPK--NL--HAKRSSTLENVSEIVAVSSCKGGVGKSTVAVNLAYSLVQRGARVGILDADIYGPSLPTMINPEDRVVRPSPT-NKGFILP
DUF59NUDuf971_parTet   SVPIVHKLYFTFS-VNEEYKIQILNRLKQIKHS-DSHKDIVSNGYVENLSID-QDGRVIIDLKLDQDYRKMKAL----CSDALKQFEWIKNLDIRMAPKKENVFTQA-NTQKRGNLQNVKKIIAVSSCKGGVGKSTIALNLTFSLQKLGFNVGIFDADVYGPSLPTLIGKEKQQLYAPED-KPKEILP
DUF59NUDuf971_tetThe   IGQLTQKPTFHFSNAVQEGKAEITKKLKEITFE-DG-SNIIDNGSILTIDIE-SSGKVTVQLKLDQNYRKLKGL----CNAKLQEIPWIKEFEIKMAPKDQ----ET-SFKKRGQLENVKKIIAVSSCKGGVGKSTVAINLAFSLLKQGHKVGIFDADIYGPSIPTLINKENAILQAPED-RPKEILP
DUF59NUDuf971_perMar   MARFGRRGFANETAAATEREKEILQQLSLIIDP-DLHKDIVTLGFVQNLTISD-EGVVVFDLKLTTPACPVRDQFIDACTRACSALPWVTDVKVTLSAKSRA--GGA-PEVKSENLSNVQNIVAVTSCKGGVGKSSVAVNLAYSIAKHGVKVGILDADIFGPSLPYLIPSTERAPADPQ--------P
DUF59NUDuf971_pauChr   ---------------MVFTTNEALQVLAVIL-DEGSRRSVIELGWISRLRIQ--NSRIIFRLELPNFANKQRDEIVKKARASLLLLEGMKDVQIEIATAPIGQAGHG-AENGRQSISGVKHILAVSSGKGGVGKSTVAVNLACALARSGLKVGLLDADIYGPNVPTMLGVEDVKPEIAGTGNQQVLSP
DUF59NUDuf971_synSpp   ----------------MTPVEQANKALQQVK-DAGSGKTALELGWIEQIRIT--PPRAVFRLSLPGFAQSQRDRIVAEARGALMALDGIEDVQIEISQGGIGQAGHG-QPAERQSIPGVRQVIAVSSGKGGVGKSTVAVNLACALAQTGLRVGLLDADIYGPNAPTMLGVADQTPEVQGSGDQQRIVP
Duf59NU_theSco         ---------------MALTEERVLEALRTVM-DPELGKDLVSLGMVGEVRLE--GGRVDLLINLTTPACPLKGQIEADIRRALHPL-GVEEVRVRFGGGVKA--------PEQYPIPGVKHVVAVGSGKGGVGKSTVAANLALALLQEGARVGLLDADLYGPSQAKMFGLEGERLKVD---QHRKILP
Duf59NU_marHyd         --------------MSRLSETDVLDALRGVN-DPELHKDLVSLGMVEQVVVD--GRKVAVKINLTTPACPLKGQIEGEVRAALERI-GAEHVEITFGASVRG--------PQQLPLPGVKNVVAVGSGKGGVGKSTVAVNLAIALSQEGARVGLLDGDIYGPSQARMLGLEGEKLRVN---EAKKIVP
Duf59NU_theRos         --------------MSELTRERVLEALRPVQ-DPELHRSLVDLGMIKEVTIE--GASVRVQVELTTPACPLRERIREDVERAVRALPGVQTVEVGFSSRVRAAGTGL---PDRQPIPGVKNTIAVASGKGGVGKSTVAVNLAVALAQEGATVGLLDADVYGPSIPLMLGAEEQ-PGLV---DNKII-P
Duf59NU_deiMar         -----------------MHQDDVLAALRTVN-DPELHRDLVSLGMVKGVRVD--GDRVDVHVELTTPACPLRGTIEADVRRAVEAA-GARDVRVEFSARVAP--------PAQPALPGVKHVLLVGSGKGGVGKSSVAANIAASLAADGARVGLMDADVYGPSIAHMMGASGEKVTAT---EDRKMRP
Duf59NU_lepFer         --------------MSTVSEELVWSALGRVI-EPDFKKDLVTLKMIENLKID--GGNLSFTIVLTTPACPLKDEMKNACLASLASVPGITNTEISFTARTTGGSF-----TGKTPIPGVKNVIAVSSGKGGVGKSTTSVNLAIALSQMGAKVGIMDADVYGPNIPMMLGITD--TPRQ---VDKKLFP
Duf59NU_myxFul         ---------------MSVTQADILSAMSKVM-DPELHVDLVKAGMVKDIRVS--GDTAKLKIELTTPACPMKGKIQADAEAALKAVPGLKSFDIEWGAQVRAAGGGM---PGGALLPKVKNIILVGAGKGGVGKSTVAVNLATALAQHGAKVGLLDADFYGPSVPLMTGLGDKRPVSP---DGKVLNP
Duf59NU_corCor         ---------------MSVSQADVMTAMSKVI-DPELHVDLVKAGMVKDVRVT--GDTVKLKIELTTPACPMKGKIQADAEAALKAVPGLKSFDIEWGAQVRGVAGGS----GGALLPGVKNILLVGAGKGGVGKSTVAVNLATSLAQHGAKVGLLDADFYGPSVPLMTGTADKRPVSP---NGKTLDP
Duf59NU_stiAur         ---------------MSVSERDILAAMSKVV-DPELHVDLVKAGMVKDIRIS--GDAVKLKIELTTPACPMKGKIQADTEAALKAVPGLKSFELEWGAQVRATGGGVGQGQGQALLPGVKNIILVGAGKGGVGKSTVAVNLATALARHGAKVGLLDADFYGPSVPLMTGITEK-PVSP---DGKTLTP
Duf59NU_anaThe         -------------MASAVTKEAVLQALSHVQ-EPELHKDLVTLGMVRDVEIE--AGKVRFRIVLTTPACPLKSRIENEARSAVLSLSGVQEVEVILDAQVPSDGR-----NRGVLSLPVRNVVAVASGKGGVGKSTVAVNLAVSLAQSGARVGLLDADIYGPNIPTMMGVQR--LPPQ---NGQKLIP
Duf59NU_anaSpp         ---------------MPLDPTTALDALRKVM-DPELRRDLVSLGMVKDVVVE--GDTVRLKVELTTPACPLKDTIGRDVKAALEGA-GFRSVELSWGAQVRAAPGAA----QGQLTPGVKNIILVGAGKGGVGKSTVAVNLAAGLARTGAKVGILDADIYGPSVPMLTGVTDR-PTSR---DGKKLEP
Duf59NU_natPha         -----------------MNEETVLDRLAAVENDPDLGDDIVSLGLVNDVNID--AETIHVDLALGAPYSPTETELAGTVRDALSE----LDREIDLTASVDT--GLS---ADEQILPDVENIIAVASGKGGVGKSTVAVNLAAGLSQLGARVGLFDADVYGPNVPRMVEADDQ-PKAT---EQETIIP
Duf59NU_halPau         -----------------MDETDVRAVLRTVE-DPDLGEDIVSLGLVNDVTVE--DETARISLALGAPYAPHESEIANRVREALND----EGIDTELSARVDT--QLS---PEEQVLPGVKNIIAVASGKGGVGKSTVAVNLAAGLAKLGARVGLFDADVYGPNVPRMVDANER-PRAT---EEQKLVP
Duf59NU_natPel         -----------------MDEAAVRDRLRTVE-DPELGDDIVSLGLVNDITVD--GDEVAIDLALGAPYSPSESDIAAEVRETLTA----EDLEPDLTASVPDRDDLT---SEDQVLPNVKNVIAVASGKGGVGKSTVAVNLAAGLSQLGARVGLFDADVYGPNVPRMVDADEP-PMAT---EDETLVP
Duf59NU_halLac         -----------------MNEADVRERLVDVR-DPDLGDDIVSLGLVNDVEVD--DDEIRISLALGAPFSPHESAIADDVRAALAD----TGLDVELSASIPD--DLE---PDEQVLPGVKNVIAVASGKGGVGKSTMAVNIAAGLSALGARVGLFDADVYGPNVPRMVSAEER-PQ-T---DGETIVP
Duf59NU_halVol         -----------------MDEADVRDRLRAVE-DPDLGDDVVSLGLVNAVEVD--GDTVRISLALGAPYSPAETDIGRRIREVLAE----DGLEVDLTAKVPT--DRD---PDEEVLPGVKNIIAVASGKGGVGKSTVAVNLAAGLSKLGARVGLFDADIYGPNVPRMVAAEEA-PQAT---QDQTIVP
Duf59NU_halXan         -----------------MDEDAVRDRLRTVE-DPELGDDIVSLGLVNDIAVD--GDEVSVDLALGAPYSPTESDIAAEAREVLIE----AGLEPDLSASVPDRDDLS---SDEQVLPGVKNVIAVASGKGGVGKSTVAVNLAAGLSQLGARVGLFDADVYGPNVPRMVDADEP-PMAT---EDETLMP
Duf59NU_halTia         -----------------MDEAELRELLASVE-DPDLEGDIVSLGLVNDVALE--NGSAHIDLALGAPFSPTETTIADRVREVIGD----AA--PDLAVELTASIDRD---TEGDVLPGVKNVVAVASGKGGVGKSTVAVNLAAGLADRGARVGLFDADIYGPNVPRMLDAHER-PEAT---EDDQIIP
Duf59NU_calSub         ---------------MLIDEQTVLNALRQVI-DPDLKIDIVTLGMIKNLVIK--DGDVSFTLELTTPACPYNKSIEDSARAAVESIPGVRSVDMRVTARVWSAKPM----AST--YPDVKNVVAVASGKGGVGKTTVAINLACSLALSGARVGLVDADIYGPTIPKIVKIVEPPRLRP---DKKVEPA
Duf59NU_cenSym         --IRLSLNNENTLTENMVGVDQVLESLGKVI-DPDLKKDIVSMGMIKDLELD--DGNLKFTLELTTPACPFNVEIEDDVRKVIGELDGIKNLNLNVTAKVMEGRSL----DEDAGMTTVKNIIGVASGKGGVGKSTVALNLALALGQTGAKVGLLDADIYGPSIPLMLGMKEAFMEVE---ANKLQPA
Duf59NU_nitSal         ----------------MVGIDQVLEKLSTVI-DPDLKKDIVSMGMIKDLELN--DGNLKFTLELTTPACPFNVEIEDDVRKAIGEISELKNFDMKVTAKVMEGRSL----EADTGMASVKNIIGVASGKGGVGKSTVSLNLALALAQTGAKVGLLDADIYGPSIPLMLGMKDGFMEVE---DNKLQPA
Consensus                                 e  vl  L  !  dpdl  di!slG !           v   leLttpacp    i    r al              a v               lpgVkn!!aV sgKGGVGKSTvavNLA  La  Ga VGllDAD YGPs p $                    P
Prim.cons.DUF59                           EADVLqALRaVIDDPDLGKDIVSLGMVKDLRIDESGGTVSFDLELTTPACPlKDEIEADVRAAL 
                                                                                      *                                   *       *   *  *                                                              *    *
DUF59NUDuf971_araTha   TEYMGVKLVSFGFA-GQG--RAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD--GKRYYPFGKGSGSEVVKQFGIPHLFDLPIRPTLSASGDSGTPEVVSDPLSDV-ARTFQDLGVCVVQQCAK
DUF59NUDuf971_medTru   TEYMGVKLVSFGFA-GQG--RAIMRGPMVSGVTNQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQIVPLTAAVIVTTPQKLSFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD--GKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPQGEV-SKIFQNLGVCVVQQCAK
DUF59NUDuf971_ostTau   VEYEGVKVVSFGFA-GQG--SAIMRGPMVSGLINQLLTTTDWGELDYLIIDMPPGTGDVQLTLCQVVPITAAVVVTTPQKLAFIDVEKGVRMFAKLAVPCVSVVENMSYFEVD--GVKHKPFGEGSGAKICEQYGVPNLLQMPIVPDLSACGDTGRPLVLRDPTCET-SSRYQEVAATVVREVAK
DUF59NUDuf971_micSpp   TEYEGVGIVSFGFA-GQG--SAIMRGPMVSGLINQMLTTTAWGDLDYLIIDMPPGTGDVQLTICQVLPITAAVVVTTPQKLAFIDVEKGVRMFSKLRVPCVAVVENMSYFDGDD-GKRYKPFGEGSGQRICDDYGVPNLFQMPIVPDLSACGDTGRPLVLVDPAGDV-STIYGAVAAKVVQEVAK
DUF59NUDuf971_thaPse   LRRGDVSLMSFGYV-NEG--SAIMRGPMVTQLLDQFLSLTNWGALDYLIMDMPPGTGDIQLTLSQRLNITAAVIVTTPQELSFVDVERGVEMFDTVNVPCIAVVENMAYLEREE-TEMIRIFGPGHKRRLSEQWGIEHTYSVPLMGQIAQNGDSGTPFILDNPKSPQ-ADIYRQLAKSVVSEVAK
DUF59NUDuf971_phaTri   LQRNGVRLMSFGYV-NDG--SAVMRGPMVTQLLDQFLSVTHWGALDYLILDMPPGTGDIQLTLTQKLNITAAVIVTTPQELSFADVVRGVEMFDTVNVPCIAVVENMAYYESAD-PEKIQIFGAGHRDRLSQQWGIEHSFSIPLLNKIAANGDNGTPFVLEFPDSPP-AKIYQELASAVVSEVAK
DUF59NUDuf971_ectSil   MTAHGVKLMSYGFV-NQG--AAIMRGPMVSQLLSQFVTLTSWGELDYLVIDMPPGTGDIQLTLCQVLNITAAVIVTTPQKLSFTDVVKGIDLFDTVNVPSVAVVENMAYYDAVD-QTVFKIFGKGHQMRLADMWGITNTIRMPLVADVASSGDSGIPFVVSKPDSDH-SESYSQLAEAVVREVAK
DUF59NUDuf971_albLai   LEFQGVKLMSFGFV-NQG--AAVMRGPMVSKLIDQLILATQWGSLDFLIVDMPPGTGDIQMSLTQQMPISAAVIVTTPQRLSTIDVEKGIVMFQNLKVPSVAVVENMAFFDCIH-GTRHYPFGRSHMQELAEKYSIEHMFQLPITQESAYSADHGKPFVLGGNDPNT-VETYKHLAEAIAREVVK
DUF59NUDuf971_parTet   IEFNGVKTMSYGYASGNQ--KAIIRGPMVSSIVVQLVQQTQWQNLDYLVVDMPPGTGDIQISLCQELNFDGAVIVTTPQRLSFIDVVKGIEMFDVLKVPTLSVVENMAEYVCPDCNHVHRPFGQGYMNMLQKQFGIATAVSIPLYGDISKYSDLGSPVVLTLPEDHTINNIYRQLANNVVHELSR
DUF59NUDuf971_tetThe   IEYEGLKTMSYGFA--RK--KAIIRGPMVSAIVTQLAMQTQWGDLDYLIVDMPPGTGDIQITLCQEIKFDGAVVVTTPQKLAFVDVIKGIEMFDELKVPTLAVVENMCLFVCDGCGKEHHPFGPGYMNMLKNQFGIQSSVQIPIYDMIAKYSDYGRPVSITLPDEHTITKIYSSLAENVHQEILK
DUF59NUDuf971_perMar   YYHNGVKLMSMGYIRPGE--SVAVRGPMVSGMIQQMLTMTDWGHLDYLIIDYPPGTGDVQLTIGQQAKVDAAVVVTTPQQLSLVDVEKGIELFDKLNIPSIAVVENMAYFKCPTCSDKHQVFGRAADSKLAEKYGIQSHVELPIDPDMARNVDSAFPFVCNEADGSEASKAFESLADDVIRGVSK
DUF59NUDuf971_pauChr   IVCYGISMVSMGLLIDKNQ-PVIWRGPMLNGIIRQFLYQVEWENKDVLVVDLPPGTGDVQLSITQAIPLVGAVIVTTPQAVSLQDARRGLAMFIQMGVNILGVIENMSVFIPPDRPERYALFGNGGGSTLAEEADVELLTQLPMEILVQQGSDRGKPIVLSQS-TSTTGKAFIALAEKIKLKFLK
DUF59NUDuf971_synSpp   IETCGIAMVSMGLLIDDHQ-PVIWRGPMLNGIIRQFLYQAEWGERDVLIVDLPPGTGDAQLSLAQAVPMAGVVIVTTPQQVSLQDARRGLAMFRQMGIPVLGVVENMSAFIPPDRPDRYALFGSGGGAQLASDYDVPLLAQIPMEMPVQEGGDTGRPIVINRS-DSASAAEFKGLAEAVLKAVTQ
Duf59NU_theSco         LEAFGLKVLSIANIVPPGQ-AMIWRGPILHGTIKQFLEEVNWGELDYLVVDLPPGTGDVQLSLAQLTKVSGGVIVTTPQEVALIDAERAADMFKKVQVPVLGVLENMSHFLCPHCGKPTPIFGEGGGKRLAERLKTRFLGEIPLTLPLRESGDRGRPILVESP-EGPEAEAFRRAARELAAALSV
Duf59NU_marHyd         LERYGIRVLSIANIAPPGQ-ALVWRGPILHGTIRQFLQDVDWGELDYLIVDLPPGTGDVQLSLSQLTQVTGGVIVTTPQDVARIDAERAADMFRKVQVPLLGVIENMAYYACPSCGERSYLFGQGGGRKLAESQNTAFLGEIPLSMPVRESGDAGTPITVAHP-DAPEAQAFRQVARQLAGQLSI
Duf59NU_theRos         GRAYGIAVMSVGYILDPEK-ALIWRGPLVSQLIRQFLSDVQWGDLDYLVIDLPPGTGDVQLTLVQTIPLSGAIIVTTPQDVALADAIKGLQMFREVKTPVLGIVENMSYFVCPHCGHVAEIFGSGGGERVANKYGVPLLGQIPIDPAVREGGDRGVPVVVGQP-GSSTAQAFREAARQAAARLSV
Duf59NU_deiMar         LERHGVKFISMGNLSPAGQ-ALVWRGPMLHSAVQQFLKDAAWGELDYLIVDLPPGTGDVQLSITQSVNVTGAVIVTTPQDVALIDAARAVDMFRKASVPILGVVENMSYFVAPDTGITYDIFGRGGARKLG---GLTVLGEVPLDTEVRQDADGGVPSVLAHP-QSAASVALRSVARTLAGRVSV
Duf59NU_lepFer         PSGHGITVMSMAFMVPPGT-PLIWRGPMLHGIIQQFCQDIAWGDLDYLVVDMPPGTGDAQLSLAQLVPLSGAIIVTTPQEVALSDSRRGLAMFQKVNVPILGIVENMSSFVCPHCHEETDIFSKGGGEKAAHELHVPFLGRIPIDLSIREGGDSGHPIAVAYP-ESPLTQSYRDIAGKLASAISI
Duf59NU_myxFul         LEAHGLKVMSIGFLVEADQ-ALIWRGPMLHGALMQLVRDVNWGELDYLVLDLPPGTGDVALTLSQSVRAAGAVLVTTPQDVALADVVRAKQMFDKVHIPVLGIVENMSQFVCPNCSHATPIFNHGGGQKAAQMFGIPFLGEIPLDLKVRVSGDSGVPVVVGAK-DSPEAKAFQDVARNIAGRVSA
Duf59NU_corCor         LVAHGLKIMSIGFLVEADQ-ALIWRGPMLHGALMQLVRDVNWGELDYLILDLPPGTGDVALTLSQSVRAAGAVLVTTPQDVALADVVRAKQMFDKVHIPVLGIVENMSQFVCPHCNKSTPIFNHGGGHKAAEMFGIPFLGEIPLDLKVREAGDSGVPVVVGHQ-DSPEAKAFQEVARAVAGRVST
Duf59NU_stiAur         MSKYGLKIMSIGFLVEPDQ-ALIWRGPMLHGALMQLVRDVNWGELDYLILDLPPGTGDVALSLSQSVRAAGAVLVTTPQDVALADVVRAKSMFDKVHIPVLGIVENMSQFICPNCSHATNIFHRGGGRKAAEMFSIPFLGEVPLELKVRESGDAGVPVVAGAP-DSREAQAFLEIARNVAGRVSA
Duf59NU_anaThe         AEAYGVQVMSIGFLVKPGQ-PLIWRGPMLHSAIRQFLADVAWNELDYMIVDLPPGTGDAQLSLAQSVPLSGGVIVTLPQRVSQEDAMRGLQMFRELNVPVLGVIENMSYLELPDGT-RMDIFGTGGGEDLAQAAEVPFLGAIPIDPGVRVGGDQGVPVVISAP-QSAPARALTAIAQKIAASLSV
Duf59NU_anaSpp         LHAHGMKVMSIGFLVDPDQ-ALIWRGPMVTGALIQLLRDVNWGDLDYLVLDLPPGTGDIPLTLAQNVRAAGVVLVSTPQDLALADVIRAKLMFDKVSIPVLGIVENMSAFVCPHCRSETAIFDKGGARTAAEKMGIRFLGDVPIDLAIREGGDKGVPVVVGQP-DSPQAAALLAVAKNVAGAVST
Duf59NU_natPha         PEKYGMKLMSMDFLVGEDD-PVIWRGPMVHKVLTQLWEDVEWGALDYMVVDLPPGTGDTQLTLLQSVPVSGAVIVTTPQKVALDDAEKGLQMFGEHDTPVLGIVENMSGFVCPDCGSEHDIFGSGGGESFADDVEMPFLGRIPLDPAVREGGDAGRPVVLDE--DDETGEALRSFTERTANMQGI
Duf59NU_halPau         PEKFGVKLMSMAFLTGKDD-PVIWRGPMVHKVLTQLWEDVEWGQLDYMVVDLPPGTGDTQLTLLQSVPVTGAVIVTTPQQVALDDANKGLQMFGKHDTPVLGIAENMSTFKCPDCGGEHDIFGHGGGAEFAEDHEMPFLGSIPLDPSVRSGGDEGEPIVLDD--ESDTGESFRTLTENVANNVGI
Duf59NU_natPel         PEKYGVKLMSMAFLTGEDD-PVIWRGPMVHKVITQLTEDVEWGHLDYLVVDLPPGTGDTQLTMLQTMPVTGAVIVTTPQDVALDDARKGLEMFAKHDTVVLGIAENMSTFACPDCGGEHDIFGSGGGEDFAEEHELPFLGSIPLDPAVREGGDGGKPTVLKD--DDTTSDALRTITENVANNTGI
Duf59NU_halLac         PERFGVKLMSMDFLTGEDD-PVIWRGPMVHKIITQLVEDVEWGELDYLVMDLPPGTGDTQLTILQTLPLTGAVIVTTPQEVALDDAVKGLRMFGKHDTNVLGIAENMAGFRCPDCGGFHEIFGSGGGKALAQEHDLPFLGGVPLDPAVRTGGDDGEPVVL-E--EGETADAFRVIVENVANNAGV
Duf59NU_halVol         PEKYGMKLMSMAFLVGDDD-PVIWRGPMVHQLLTQLVEDVEWGSLDYLVLDLPPGTGDTQLSILQTLPLTGAVIVTTPQNVALDDANKGLRMFGKHDTNVLGIVENMSTFRCPDCGNRHDIFGAGGGREFAASNDLPFLGALPLDPAVREGGDGGKPIVLED--DDETADAFRVMTENIADMVGI
Duf59NU_halXan         PEKYGVKLMSMAFLTGEDD-PVIWRGPMVHKVITQLTEDVEWGHLDYLVVDLPPGTGDTQLTMLQTMPVTGAVIVTTPQDVALDDARKGLEMFAQHDTVVLGIAENMSSFACPDCGSQHDIFGSGGGREFADEHDMPFLGSIPLDPSVREGGDSGKPTVLDD--DSEVGESFRTITENVANNTGI
Duf59NU_halTia         PEKHGMKLMSMDFLLGEDD-PVIWRGPMVHQTLTQLFEDVQWGDLDYLVVDLPPGTGDTQLTLLQTVPVTGAVIVTTPQGVALDDARKGLEMFGKHETPVLGIIENMSSFKCPDCGSEHAIFGEGGGREFADQVQMPFLGEIPLDPEIRERGDEGRPAVLAD--DLDVSGAFRNFVANTANNQGI
Duf59NU_calSub         KMMLGIKVMSLGLFVDEGT-AVIWRGPLVASAVKQLLTEAQWGELDYLIVDLPPGTGDASLTLAQTMPLTGVVIVTTPQQAASVIAAKALSMFRRLGVTIIGIVENMSYYVCPECGKESSLFGQSHTDKMAAELDVEVLGRIPMSPDVSVNHDQGVPIVLAAP-SSPAAKAFDEAAKKIAAKISI
Duf59NU_cenSym         EAS-GIKVVSFGFFAEQAHKAAIYRGPIISGILKQFLVDTNWSDLDYLIVDLPPGTGDIPLTLAQTIPITGILVVTTPQNVASNVAVKAVGMFEKLNVPIIGVVENMSGFVCNKCGEKHNVFGEGGAKRISEQFKIPLIGEIPLTAGIMAGSEEGRPIILTDP-DSPSSNAFRSSAKNIAAQCSI
Duf59NU_nitSal         DSH-GLKVVSFGFFADQSNQAAIYRGPIISGILKQFLVDTNWSDLDYLIVDLPPGTGDIPLTLAQTIPITGILVVTTPQDVASNVAVKAVSMFEKLNVPIIGVVENMSHFICPNCNEKHYIFGEGGAKKISEQFNMPFLGEIPLNSGIMAGSDLGKPIMITNP-DSPSAVAFRKSAKNIAAQCSI
Alignment of bacterial PaaD proteins:
            <-----------------------------------------DUF59--------------------------------------------->                       <--------- unknown 6-Cys domain ------->
                                                        *                                                           -             *  *               *     *  *        *  conserved cysteines
PaaD_escCol WALLSQIPDPEIPVLTITDLGMVRNVTQMGEGWVIG-FTPTYSGCPATEHLIGAIREAMTTNGFTPVQVVLQLDPAWTTDWMTPDARERLREYGISPPAG--HSC--HA--HLPPEVRCPRCASVHTTLISEFGSTACKALYRCDSCREPFDYFKCI Escherichia coli
PaaD_entAsb WSLLSQIPDPEVPVLTITDLGMVRNVTALGEGWVIG-FTPTYSGCPATEHLLGAIRETMTAHGFTPVHIVLQLEPAWTTDWMTADARERLREYGISPPVG--HSC--HA--HAPAEVSCPRCASTDTSLISEFGSTACKALYRCNSCREPFDYFKCI Enterobacter asburiae
PaaD_kleOxy WEVLSAIPDPEVPVLTITDLGMVRSVDRRGDGWVIG-FTPTYSGCPATEHLLGEIRAAMTENGYAPVHIVLQLDPPWTTDWMGPEARERLRQYGISPPQG--HAC--HA--HMPEEVVCPRCASRHTSLISEFGSTACKALYRCDSCREPFDYFKCI Klebsiella oxytoca
PaaD_citFre WGLLSAISDPEVPVLTITDLGMVRSVERCGDGWVIG-FTPTYSGCPATEHLLGEIRAVMADHGYTPVHIVLQLDPPWTTDWMSPDARERLRQYGISPPQA--HAC--HA--EMPTDVQCPRCASTHTSLISEFGSTACKALYRCDSCREPFDYFKCI Citrobacter freundii
PaaD_serPro WHCLQQISDPELPVLSITDLGMVRDVVADGGGWRIT-FTPTYSGCPATEFLLEAIEQQLTAAGFSPVKVDIRLSPAWTTDWMNADARERLREYGVAPPQG--HTC-DKP--QAHGPVPCPRCGSTHSEKISEFGSTACKALYRCCDCREPFDYFKCI Serratia proteamaculans
PaaD_hafAlv WQCLHAISDPELPVLSITDLGMVRGVTPLKKGWLVT-FTPTYSGCPATEFLISAIQETLTEAGFSPVQVEICLTPAWTTDWMNVEAKNRLREYGVAPPQG--LIC-EKP--LSTETVQCPRCGSHDSQKVSEFGSTACKALYRCKQCLEPFDYFKCI Hafnia alvei
PaaD_serOdo WHCLQQISDPELPVLSITDLGMVRSVEAEGTGWRVT-FTPTYSGCPATEFLLEAIERQLFEAGFSPVRVEVRLDPAWTTDWMNAEARARLRQYGVAPPQG--HSC-DRP--LSHGPVPCPRCGSEHTEKISEFGSTACKALYRCRACREPFDYFKCI Serratia odorifera
PaaD_proStu WQQLHQIPDPELPALSITDLGMIRNVFATSRGWKVM-FTPTYSGCPATEFLINEIKNVLEHAGFPNVEIEVVLTPAWTTDWMNQDAKQRLREFGIAPPAG--KAC-EHP--EKSGPICCPRCDSQHTEKISEFGSTACKALYRCLECFEPFDYFKCI Providencia stuartii
PaaD_psyIng WKLLSAIPDPEIPAITIAELGMLRAVDFENEQWVVT-FTPTYSGCPATEMLINDITQAMTSAGHTPVKVNVSLDPAWTTDWMSEASKKKLSDYGIAPPQG--KAC-FEG--SLPPSVNCPNCGGQSTQLISEFGSTACKAHYKCLTCYEPFDYFKCI Psychromonas ingrahamii
PaaD_aciRad WETLKQVADPEIPVLSVVDLGMIRGVELNEEDQIIVRLTPTYSGCPATDLLKAEITQAFTVQGLVPVQVVVDLSEVWTTDWMSESGKQKLQQYGIAPPQGEAHSCGTHV--ALSDGIKCPRCHSQHTKLLSEFSSTACKALYRCQQCLEPFDYFKCI Acinetobacter radioresistens
PaaD_psePut WAVLGQVMDPEVPVVSVVDLGIVRDVDW-RAGHLHLVVTPTYSGCPATEVIEGDIRQALEQAGFTAPDLERRLTPAWSTDWISELGRERLRAYGIAPPQGSASKRSLLG---EPPQVCCPQCGSAHTELLSQFGSTACKALYRCRECLEPFDYFKCI Pseudomonas putida
PaaD_pseSpp WDAVCDVPDPEVPVLTIEDLGVLRDVHVQADGSVQVTITPTYTGCPAMSMFAFDIEAALLNAGFDKVEVKTVLNPAWTTDWLSEKAREKLRAYGIAPPNGKAS----RRALFGEEQVRCPKCNSANTSRISEFGSTACKALYRCNDCSEPFDYFKCI Pseudovibrio spp
PaaD_fluTaf WSYLEEVPDPEVPVLSIIDLGIVRGVKVISDSEVHITITPTYSGCPAMNYIEKSIQEILTEKGFKTIHIDTILAPAWTTDWMSENGKKKLLEYGIAPPVNEVDKLVLFG---TAPTVKCPQCGSKDTKMLSQFGSTACKALYQCTSCLEPFDYFKCL Fluviicola taffensis
PaaD_achXyl YAWLQEVPDPEIPVLSVVDLGVVRDVAW-DGDACVVVITPTYSGCPAMREITEDIRQVLARHGVGEVRVETRLSPAWTTDWMSEKGRAALKDYGIAAPAQQAIDISGISRRNAGPPIECPRCGSRDTRLVSNFGSTSCKALYRCVSCREPFDYFKTH Achromobacter xylosoxidans
PaaD_sinMel WHWLSQVPDPEIPVISVTDLGIVRNVDW-DGETLVVTVTPTYSGCPATAVINLDIERRLTENGIESVRLERQLSPAWTTDWISAEGREKLESYGIAAPVDGTGAIEGLEG-GAALTVSCPRCGSTRTDKVSQFGSTPCKASYRCRDCLEPFDYFKCI Sinorhizobium meliloti
PaaD_oceSpp WDLLDEVKDPEVPVLTIWDLGILRDIEREGD-SVIVTITPTYSGCPAMDNISTDVTQVLNDAGYADVKVKTSLSPAWSSEWMSPEGRRKLRNYGIAPPEDADL---DEDGLTPDAHAQCPHCSSRNTRRVSEFGSTACKALFQCNDCNEPFDYFKKI Oceanospirillum spp
PaaD_polGil WGWLEEVPDPEIPVLSLVDLGVIRSIGW-DGGRLVVKVTPTYSGCPATSVINFEIEKALRDHGITDLVLERQLSPAWTTDWISESGREKLRAYGIAPPVAGT-AVCGSGG-QADPVVACPRCGSTDTAQVSRFGSTPCKAAYRCNACLEPFDYFKCI Polymorphum gilvum
PaaD_marAlg WALLEEVKDPEVPAVSVVELGIVRAVRW-DGKELSIDVTPTYSGCPATELIEELIIEAMRAAGFRAPNINQVLTPAWTTDWITAEGKEKLRAFGIAPPEGSSSKLSLLG---EPDIIACPHCGSTDTEQVSEFGSTACKALYRCTECLEPFDYFKCI Marinobacter algicola
PaaD_niaKor WSILEEVCDPEVPVLTIVDLGIVRDVKVNEE-AVEVVITPTYSGCPAMDVIRMNIRMALLQHEYKNVQITTVLSPAWTTDWMTEAGKEKLKAYGIAPPNVKQQVC-NTHLFAEDEAVQCPHCNSYNTRRISEFGSTACKSLYQCNDCQEPFDYFKCH Niastella koreensis
PaaD_artPhe WDIAATVVDPEIPVLSIADLGILRDVEVAGD-HVKVTITPTYSGCPAMDAIRDDVKTAFEKEGYTDVEVDLVLSPAWTTDWMTEEGKAKLQEYGIAPPTGHSKAARHAGPIRLSMAVKCPQCASLNTKELTRFGSTSCKALYVCQDCKEPFDYFKVL Arthrobacter phenanthrenivorans
PaaD_burBac WALLAEVMDPEVPVISVLDLGLVREVLD-DGQTLDVVLTPTYSGCPATEIIEASVRDALERGGLGPLRVAMRRAPAWTTDWISEAGREKLRAYGIAPP-GAVDPQAAQTIHLVSRRVPCPRCGDTHTERLSAFGATACKALYRCLACREPFEHFKPI Burkholderiales bacterium
Consensus   W  l  ! DPE Pvls! #LG vR !         v  TPTYSGCPAt  i   !  al   G   v v   L PaWtTDWmse grekLr YG!apP g                ! CPrCgs  T   SeFGSTaCKAlYrC  C EPFDYFKci 
Prim.cons.  WALLSQVPDPEVPVLSITDLGMVRDVEWEGdGWVvVTFTPTYSGCPATEliLGDIRQALTEAGFTPVhVEvQLSPAWTTDWMSEEGREKLREYGIAPPQG AHACS HGGL APPPVQCPRCGSTHTELISEFGSTACKALYRCNsCREPFDYFKCI

PaaD_conSeq   LLSQVPDPEVPVLSITDLGMVRDVEWEGDGWVVVTFTPTYSGCPATELILGDIRQALTEAGFTP-VHVEVQL  consensus PaaD sequence
              LL+++ DPE P L++  L +V+D+E EGD ++ V  TPT   C    LI   IR  L E    P  HV+V++  38% identical, 55% similar
FAM96B_schPom LLAKINDPEHP-LTLAQLSVVKDIEVEGDSYITVHITPTIPHCSMCTLIGLCIRVRL-ERCLPPRFHVDVKV  Schizosaccharomyces pombe NP_594677
Other DUF59 domains of interest:

>DUF59a_theSco Thermus scotoductus YP_004202903 uninformative genomic context 3CQ1 Q53W28 rhamnose-related
MSETNPLETQALALLENVYDPELGLDVVNLGLIYELRVEPPLAYVRMTLTTPGCPLHDSMGDAVRQALSRIPGVEEVQVELTFDPPWTPARLSEKARRALGWG

>DUF59b_theSco Thermus scotoductus CP001962 REGION: 574428..574829 apparently SufT but uninformative genomic context
MDERHREGLPEGQAGLQEGNANQAGGKEGLPTKEQVLEALKVVYDPEIPVNIVDLGLVYDVEIHENGVVDLTMTLTAIGCPAQDMVKADAEMAVMRLPGVQGVNVEFVWTPPWTPARMTEEGKRMMRMFGFNV

>PaaD_theSco Thermus scotoductus CP001962 REGION: 1148207..1168662 Paa operon: PaaG PaaB PaaI PaaJ PaaN 
MVERYWEALKGVKDPEIPVLNIVEMGMVLGVEAEGEKVRVRFRPTFSGCPALRLIREEIEKALREAGAKEVEVVEARTPWSTEDMAEEARRKLLGYGVAPPLPLPLAGKDPPCPRCGSREVVLKNTFGATLCKMLYQCAACGEVFEAFKTV

>Duf59c.NBP35_theSco Thermus scotoductus CP001962 REGION: 1432113..1433165 uninformative genomic context
MALTEERVLEALRTVMDPELGKDLVSLGMVGEVRLEGGRVDLLINLTTPACPLKGQIEADIRRALHPLGVEEVRVRFGGGVKAPEQYPIPGVKHVVAVGS
GKGGVGKSTVAANLALALLQEGARVGLLDADLYGPSQAKMFGLEGERLKVDQHRKILPLEAFGLKVLSIANIVPPGQAMIWRGPILHGTIKQFLEEVNWG
ELDYLVVDLPPGTGDVQLSLAQLTKVSGGVIVTTPQEVALIDAERAADMFKKVQVPVLGVLENMSHFLCPHCGKPTPIFGEGGGKRLAERLKTRFLGEIP
LTLPLRESGDRGRPILVESPEGPEAEAFRRAARELAAALSVQAFIALPMA

>Duf59.NBP35_araTha Arabidopsis thaliana Q6STH5
MPLLHPQSLRHPSFEIQTQRRSNSTTRLLLSHKFLHSQASIISISRTRILKRVSQNLSVAKAASAQASSSVGESVAQTSEKDVLKALSQIIDPDFGTDIV
SCGFVKDLGINEALGEVSFRLELTTPACPVKDMFENKANEVVAALPWVKKVNVTMSAQPAKPIFAGQLPFGLSRISNIIAVSSCKGGVGKSTVAVNLAYT
LAGMGARVGIFDADVYGPSLPTMVNPESRILEMNPEKKTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQL
TLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKRYYPFGKGSGSEVVKQFGIPHLFDLPIRPTLSASGDSGTPEVVSDP
LSDVARTFQDLGVCVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSVDEWTGEQKVLYGDVAEDIEPEDIRPMGNYAVSI
TWPDGFSQIAPYDQLEEIERLVDVPPLSPVEV

>DUF59_bacAnt Bacillus anthracis Q81XF6 3LNO
MSQEAFENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITMTMTSIGCPMAGQIVSDVKKVLSTNVPEVNEIEVNVVWNPPWSKERMSRMAKIALGIRD

>DUF59_halHal Halobacillus halophilus HE717023 10001..10312 gene order: yitW MobB moaE moaD (molybdopterin synthase sulfur carrier)
MSTATEENALGALENVIDPELGIDIVNLGLVYGVDIDPDGNATVTMTLTAMGCPLAAHIEQDVKGCLADLPEINQVAVNIVWNPPWTKDRMSRYAKIALGIPD

>YITW_bacSub Bacillus subtilis P70949
MEEALKENIMGALEQVVDPELGVDIVNLGLVYDVDMDEDGLTHITMTLTSMGCPLAPIIVDEVKKALADLPEVKDTEVHIVWNPPWTRDKMSRYAKIALGIQ

>YitW_strGal Streptococcus gallolyticus F0VS24 N6adenine-specific DNA methylase
MSEQKYTEEEVAKIKDRILEALEMVIDPELGIDIVNLGLVYEIRFEQNGHTEIDMTLTTMGCPLADLLTDQIHDVMREIPEVTNTEVKLVWYPAWTVDKMSRYARIALGIR

>Duf59_theThe Thermus thermophilus Q53W28 TTHB138 dDTP-4-Keto-L-Rhamnose reductase-related dimer
MTARNPLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGWG

>Duf59_theMar Thermotoga maritima Q9WYV7 1WCJ TM_0487
MPMSKKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAGMILSDAEEAIKKIEGVNNVEVELTFDPPWTPERMSPELREKFGV
 
>DUF59.NUBPL.Duf971_araTha Arabidopsis thaliana Q6STH5 HCF101 Viridiplantae
MPLLHPQSLRHPSFEIQTQRRSNSTTRLLLSHKFLHSQASIISISRTRILKRVSQNLSVAKAASAQASSSVGESVAQTSEKDVLKALSQIIDPDFGTDIV
SCGFVKDLGINEALGEVSFRLELTTPACPVKDMFENKANEVVAALPWVKKVNVTMSAQPAKPIFAGQLPFGLSRISNIIAVSSCKGGVGKSTVAVNLAYT
LAGMGARVGIFDADVYGPSLPTMVNPESRILEMNPEKKTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQL
TLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKRYYPFGKGSGSEVVKQFGIPHLFDLPIRPTLSASGDSGTPEVVSDP
LSDVARTFQDLGVCVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSVDEWTGEQKVLYGDVAEDIEPEDIRPMGNYAVSI
TWPDGFSQIAPYDQLEEIERLVDVPPLSPVEV

>DUF59.NUBPL.Duf971_medTru Medicago truncatula BT138281
MQAVQASSSPHFSIHSSKPPHSSTCSLVTSSVNVKCSGFSLREQSSLWTSYNKRVILKSSFSAKAASVEVGSSSISTGTAEDDVLKALSQIIDPDFGTDI
VTCGFVKDLQIDKALGEVSFRLELTTPACPIKDVFEKQANEVVAVLPWVKNVNVTMSAQPAKPLFAEQLPAGLQTISNIIAVSSCKGGVGKSTVAVNLAY
TLADMGARVGIFDADIYGPSLPTMVSSENRILEMNPEKKTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVTNQLLTTTEWGELDYLVIDMPPGTGDIQ
LTLCQIVPLTAAVIVTTPQKLSFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVAD
PQGEVSKIFQNLGVCVVQQCAKIRQQVSTAVTYDKSVKAIRVKVPDSDEEFFLHPATVRRNDRSAQSVDEWTGEQKLQYTDIPDYIEPEEIRPMGNYAVS
ITWPDGFSQIAPYDQLQTMERLVGVS

>DUF59.NUBPL.Duf971_ostTau Ostreococcus tauri XP_003083908 Viridiplantae
MKTKNSSITRTKSPTLERLNDADASMIDANAPYRVELAESDLIAAESVRRAIEEPKGHLTRCLAKRLGGDALRDALKETLRIERLEGGSRYEEGFKGSGV
WRERTRAGLFLVVIKKKHDAKLVSAALAEIDVVYASFRDWKTGHKHFTSRRALHASSTHKTRLRDRTRNVGHVRLVSERSRISTGERGEFQFSDKSRRIN
SNRVVRARHAPSTSTEGDLMDTTSMPAIYSAPDGSKESEVLSKLRRVIDPDFGEDIVNCGFVKALVIDESAGSVLFAIELTTPACPVKAEFERQAKAFVE
ELDWVKRVSVTMTAQPARNDAPETVEGLRRVSHIIAVSSCKGGVGKSTTSVNLAYTLAMMGAKVGILDADVYGPSLPTMISPDVPVLEMDKETGTIKPVE
YEGVKVVSFGFAGQGSAIMRGPMVSGLINQLLTTTDWGELDYLIIDMPPGTGDVQLTLCQVVPITAAVVVTTPQKLAFIDVEKGVRMFAKLAVPCVSVVE
NMSYFEVDGVKHKPFGEGSGAKICEQYGVPNLLQMPIVPDLSACGDTGRPLVLRDPTCETSSRYQEVAATVVREVAKLNNGKKPRVDIDPGYDGAFRVEI
PGENNDKAFWITAKNVRLSDESARVKGSDESPDRLLNGAPIPDDIAPVEMSVIGNYAMSITWPDGLSQVAAFSTLAKLERLPARAS

>DUF59.NUBPL.Duf971_micSpp Micromonas sp. XP_002502646 Viridiplantae
MATLAAIRPSDSRLGARLKVGGTGGRIARKTVTAGAGRRTTSTRRGPVSIRAHASSSSPSITSAPDGSREADVLNALRNVIDPDFGEDIVNCGFVKDLRV
SDAGDVTFTLELTTPACPVKEEFDRLSKQYVTALEWAKSCNVNMTAQPVTNDMPDAVEGLKGVRHIIAVSSCKGGVGKSTTSVNLAYTLRMMGAKVGIFD
ADVFGPSLPTMTSPEQAVLQMDKETGSITPTEYEGVGIVSFGFAGQGSAIMRGPMVSGLINQMLTTTAWGDLDYLIIDMPPGTGDVQLTICQVLPITAAV
VVTTPQKLAFIDVEKGVRMFSKLRVPCVAVVENMSYFDGDDGKRYKPFGEGSGQRICDDYGVPNLFQMPIVPDLSACGDTGRPLVLVDPAGDVSTIYGAV
AAKVVQEVAKLQAGPKGSLALDTEGVAGVDGALRVQLADEGGMPFYVRGCDVRRSDKSATADGESKKADFLMDGVTPVPDDIAPVEAHVVGNYAVQISWP
DGFSQVATFAQIQALSRLPAGAKVGA

>DUF59.NUBPL.Duf971_thaPse Thalassiosira pseudonana XP_002293925 frag stramenopiles
QSQILAALSVINDPDLNADIVSLGFVQNLKIDESSNIVSLDLELTTPACPVKDLFVQQCQDIINGLAWTRGADVTLTSQPTAAPSDAPLGMSQIGAVIAV
SSCKGGVGKSTTAVNLAFALESLGAKVGIFDADVYGPSLPTMVTPEDDNVRFVGRQIAPLRRGDVSLMSFGYVNEGSAIMRGPMVTQLLDQFLSLTNWGA
LDYLIMDMPPGTGDIQLTLSQRLNITAAVIVTTPQELSFVDVERGVEMFDTVNVPCIAVVENMAYLEREETEMIRIFGPGHKRRLSEQWGIEHTYSVPLM
GQIAQNGDSGTPFILDNPKSPQADIYRQLAKSVVSEVAKIKFCTGKGGRPSVSYDVEKSILRVDDGDIQNATISPAELRRGCRCAACVEELTGKQILNPA
SISESVKPLNMSPTGNYALSVDWSDGHRSLYPYRQIRSM

>DUF59.NUBPL.Duf971_phaTri Phaeodactylum tricornutum XP_002186426 frag stramenopiles
EVLSTLKSVIDPDLGSDIVTLGFVQNLKLDGRDVSFDVELTTPACPVKEQFQLDCQQLVQDLPWTNNIQVTMTAQPSVQETATLGMSQVGAVIAVSSCKG
GVGKSTTAVNLAFSLQRLGATVGIFDADVYGPSLPTMITPQDDTVRFVGRQVAPLQRNGVRLMSFGYVNDGSAVMRGPMVTQLLDQFLSVTHWGALDYLI
LDMPPGTGDIQLTLTQKLNITAAVIVTTPQELSFADVVRGVEMFDTVNVPCIAVVENMAYYESADPEKIQIFGAGHRDRLSQQWGIEHSFSIPLLNKIAA
NGDNGTPFVLEFPDSPPAKIYQELASAVVSEVAKTKFAKSMRPSVQYDAESHLLQVSQNGVGSTDEEHVATLPPAELRRACRCAACVEELTGRQILVPSS
VSDKIAPRNMVPTGNYALSVDWSDGHRSLYPYRQIRAL

>DUF59.NUBPL.Duf971_ectSil Ectocarpus siliculosus CBJ25905 stramenopiles
MHMQLKRPCVVAAAVASLQCLCSKAFVQPFSQHRAKQGIWPHQYSCKSTSLPVQQRARSYHVSMMTETTSDTPPGRKDEVLAVLSAVMDPDLSMDIVSLG
FIKELEISGEDEGRQVVTFDVELTTPACPVKAQFQQDCRDLVEALPWVDRAEVTMTAQPVRDVSDTVPTGLSKVATIIAVSSCKGGVGKSTTAVNLAFAL
DKQGAKVGILDADIYGPSLPTMVKPDREEVEFVGNQIRPMTAHGVKLMSYGFVNQGAAIMRGPMVSQLLSQFVTLTSWGELDYLVIDMPPGTGDIQLTLC
QVLNITAAVIVTTPQKLSFTDVVKGIDLFDTVNVPSVAVVENMAYYDAVDQTVFKTGLESNIEDLLTLDGDELSAAAAREGLASPPQDETALRAAVIAEV
MKKRASTKQREYIFGKGHQMRLADMWGITNTIRMPLVADVASSGDSGIPFVVSKPDSDHSESYSQLAEAVVREVAKLKFSDNDRPMLSFQPAEGTVTIET
SGGKQVMAAADLRRQCRCALCVEEFSGKPLLDPASVPENIVPTEFAPIGNYAVSVKWDDGHSSLYPYKNFAMGYKPRTKRPELSPV

>DUF59.NUBPL.Duf971_albLai Albugo laibachii CCA21133 stramenopiles
MGNKPSRIQSSDHATDLNPEDAFDGDSVTKCTIGLTPDLINHLNDLEKANKSPHSSDASPNERLIQIDENMYRKQLENAYRKGEEDGRLKIGREIQELQS
STSHQAKEAKKLEVEANARIRELVDEISQKKYNAPIKQVQCTEERLACLKCYQENPETVLRCKEVADAFIQCGQEATDYNVFAIMKIMRHLPPVRLSRWT
FSSSKHLLYGIKSSQLLRVQSLPSCSYSTRQNALLEMDILSKLRQVPDQLGLKSDIVTLGRVKNVQLSLQEKSVYLTLEAPNGALLDVAEQWKKDSMESL
RELDWIQSLHIETARPKPKNLHAKRSSTLENVSEIVAVSSCKGGVGKSTVAVNLAYSLVQRGARVGILDADIYGPSLPTMINPEDRVVRPSPTNKGFILP
LEFQGVKLMSFGFVNQKAAPGAGGVGAAVMRGPMVSKLIDQLILATQWGSLDFLIVDMPPGTGDIQMSLTQQMPISAAVIVTTPQRLSTIDVEKGIVMFQ
NLKVPSVAVVENMAFFDCIHGTRHYPFGRSHMQELAEKYSIEHMFQLPITQESAYSADHGKPFVLGGNDPNTVETYKHLAEAIAREVVKLRHKALLAPEF
LFNPARGILLRSYTSTHAKEITISAAQLRAQCRCAQCVDEFTGKQLLDITKISTEIVPTTIQRKGNYAYAVAWSDGHSASLYTDQHLQQLISEKSSS

>DUF59.NUBPL.Duf971_parTet Paramecium tetraurelia XP_001429812 Alveolata
MLRRLTASVPIVHKLYFTFSVNEEYKIQILNRLKQIKHSDSHKDIVSNGYVENLSIDQDGRVIIDLKLDQDYRKMKALCSDALKQFEWIKNLDIRMAPKK
ENVFTQANTQKRGNLQNVKKIIAVSSCKGGVGKSTIALNLTFSLQKLGFNVGIFDADVYGPSLPTLIGKEKQQLYAPEDKPKEILPIEFNGVKTMSYGYA
SGNQKAIIRGPMVSSIVVQLVQQTQWQNLDYLVVDMPPGTGDIQISLCQELNFDGAVIVTTPQRLSFIDVVKGIEMFDVLKVPTLSVVENMAEYVCPDCN
HVHRPFGQGYMNMLQKQFGIATAVSIPLYGDISKYSDLGSPVVLTLPEDHTINNIYRQLANNVVHELSRSDLTKTPTVRYDTGKRVIIIRDFDGKEKPIK
SVELRSKCNCALCVDEFTGRRLNQNQQLDQEVYPYKIEPKGNYAVAIVWSDGHRSSIYPYKRLWSDEIIEHKS

>DUF59.NUBPL.Duf971_tetThe Tetrahymena thermophila XP_001007903 Alveolata
MIRNTVQLFKQCARSATILKKLNLNSQSFSNTIKIGQLTQKPTFHFSNAVQEGKAEITKKLKEITFEDGSNIIDNGSILTIDIESSGKVTVQLKLDQNYR
KLKGLCNAKLQEIPWIKEFEIKMAPKDQETSFKKRGQLENVKKIIAVSSCKGGVGKSTVAINLAFSLLKQGHKVGIFDADIYGPSIPTLINKENAILQAP
EDRPKEILPIEYEGLKTMSYGFARKKAIIRGPMVSAIVTQLAMQTQWGDLDYLIVDMPPGTGDIQITLCQEIKFDGAVVVTTPQKLAFVDVIKGIEMFDE
LKVPTLAVVENMCLFVCDGCGKEHHPFGPGYMNMLKNQFGIQSSVQIPIYDMIAKYSDYGRPVSITLPDEHTITKIYSSLAENVHQEILKLQNGNNEPPI
VRYQTGNSLVIVEKNNGEIKKMKADVLRKHCNCALCVDEFTGKRLIKDDTIDNEVYPYKIEPKGNYAVAIIWSDGHRSSIYPYDTLFSDKIPAYEEPEKK
KSACSTSK

>DUF59.NUBPL_perMar Perkinsus marinus XP_002785765 Alveolata
MARFGRRGFANETAAATEREKEILQQLSLIIDPDLHKDIVTLGFVQNLTISDEGVVVFDLKLTTPACPVRDQFIDACTRACSALPWVTDVKVTLSAKSRA
GGAPEVKSENLSNVQNIVAVTSCKGGVGKSSVAVNLAYSIAKHGVKVGILDADIFGPSLPYLIPSTERAPADPQPYYHNGVKLMSMGYIRPGESVAVRGP
MVSGMIQQMLTMTDWGHLDYLIIDYPPGTGDVQLTIGQQAKVDAAVVVTTPQQLSLVDVEKGIELFDKLNIPSIAVVENMAYFKCPTCSDKHQVFGRAAD
SKHLAEKYGIQSHVELPIDPDMARNVDDVKASAFPFVCNEAFDGSEASKAFESLADDVIRGVSKVL

>DUF59.NUBPL_pauChr Paulinella chromatophora YP_002049254 Rhizaria no Duf971
MVFTTNEALQVLAVILDEGSRRSVIELGWISRLRIQNSRIIFRLELPNFANKQRDEIVKKARASLLLLEGMKDVQIEIGSTVPATAPIGQAGHGAENGRQ
SISGVKHILAVSSGKGGVGKSTVAVNLACALARSGLKVGLLDADIYGPNVPTMLGVEDVKPEIAGTGNQQVLSPIVCYGISMVSMGLLIDKNQPVIWRGP
MLNGIIRQFLYQVEWENKDVLVVDLPPGTGDVQLSITQAIPLVGAVIVTTPQAVSLQDARRGLAMFIQMGVNILGVIENMSVFIPPDRPEQRYALFGNGG
GSTLAEEADVELLTQLPMEILVQQGSDRGKPIVLSQSTSTTGKAFIALAEKIKLKFLKVE

>Duf59.NBP35_theSco Thermus scotoductus CP001962 REGION: 1432113..1433165 uninformative genomic context
MALTEERVLEALRTVMDPELGKDLVSLGMVGEVRLEGGRVDLLINLTTPACPLKGQIEADIRRALHPLGVEEVRVRFGGGVKAPEQYPIPGVKHVVAVGS
GKGGVGKSTVAANLALALLQEGARVGLLDADLYGPSQAKMFGLEGERLKVDQHRKILPLEAFGLKVLSIANIVPPGQAMIWRGPILHGTIKQFLEEVNWG
ELDYLVVDLPPGTGDVQLSLAQLTKVSGGVIVTTPQEVALIDAERAADMFKKVQVPVLGVLENMSHFLCPHCGKPTPIFGEGGGKRLAERLKTRFLGEIP
LTLPLRESGDRGRPILVESPEGPEAEAFRRAARELAAALSVQAFIALPMA

>Duf59.NBP35_marHyd Marinithermus hydrothermalis YP_004367725
MSRLSETDVLDALRGVNDPELHKDLVSLGMVEQVVVDGRKVAVKINLTTPACPLKGQIEGEVRAALERIGAEHVEITFGASVRGPQQLPLPGVKNVVAVGSGKGGVGKSTVAVNLAIALSQEGARVGLLDGDIYGPSQAR
MLGLEGEKLRVNEAKKIVPLERYGIRVLSIANIAPPGQALVWRGPILHGTIRQFLQDVDWGELDYLIVDLPPGTGDVQLSLSQLTQVTGGVIVTTPQDVARIDAERAADMFRKVQVPLLGVIENMAYYACPSCGERSYLF
GQGGGRKLAESQNTAFLGEIPLSMPVRESGDAGTPITVAHPDAPEAQAFRQVARQLAGQLSIRNLSTLPMV

>Duf59.NBP35_theRos Thermomicrobium roseum YP_002521772
MSELTRERVLEALRPVQDPELHRSLVDLGMIKEVTIEGASVRVQVELTTPACPLRERIREDVERAVRALPGVQTVEVGFSSRVRAAGTGLPDRQPIPGVKNTIAVASGKGGVGKSTVAVNLAVALAQEGATVGLLDADVY
GPSIPLMLGAEEQPGLVDNKIIPGRAYGIAVMSVGYILDPEKALIWRGPLVSQLIRQFLSDVQWGDLDYL
VIDLPPGTGDVQLTLVQTIPLSGAIIVTTPQDVALADAIKGLQMFREVKTPVLGIVENMSYFVCPHCGHVAEIFGSGGGERVANKYGVPLLGQIPIDPAVREGGDRGVPVVVGQPGSSTAQAFREAARQAAARLSVEAVKKPRKPVMMLQPKR

>Duf59.NBP35_deiMar Deinococcus maricopensis YP_004170951 ParA/MinD-like
MHQDDVLAALRTVNDPELHRDLVSLGMVKGVRVDGDRVDVHVELTTPACPLRGTIEADVRRAVEAAGARDVRVEFSARVAPPAQPALPGVKHVLLVGSGKGGVGKSSVAANIAASLAADGARVGLMDADVYGPSIAHMMG
ASGEKVTATEDRKMRPLERHGVKFISMGNLSPAGQALVWRGPMLHSAVQQFLKDAAWGELDYLIVDLPPGTGDVQLSITQSVNVTGAVIVTTPQDVALIDAARAVDMFRKASVPILGVVENMSYFVAPDTGITYDIFGRG
GARKLGGLTVLGEVPLDTEVRQDADGGVPSVLAHPQSAASVALRSVARTLAGRVSVQALDVLPMV

>Duf59.NBP35_lepFer Leptospirillum ferrooxidans YP_005469663
MSTVSEELVWSALGRVIEPDFKKDLVTLKMIENLKIDGGNLSFTIVLTTPACPLKDEMKNACLASLASVPGITNTEISFTARTTGGSFTGKTPIPGVKNVIAVSSGKGGVGKSTTSVNLAIALSQMGAKVGIMDADVYGP
NIPMMLGITDTPRQVDKKLFPPSGHGITVMSMAFMVPPGTPLIWRGPMLHGIIQQFCQDIAWGDLDYLVVDMPPGTGDAQLSLAQLVPLSGAIIVTTPQEVALSDSRRGLAMFQKVNVPILGIVENMSSFVCPHCHEETD
IFSKGGGEKAAHELHVPFLGRIPIDLSIREGGDSGHPIAVAYPESPLTQSYRDIAGKLASAISISNAGAIPIQIGNFGG

>Duf59.NBP35_myxFul Myxococcus fulvus YP_004668407
MSVTQADILSAMSKVMDPELHVDLVKAGMVKDIRVSGDTAKLKIELTTPACPMKGKIQADAEAALKAVPGLKSFDIEWGAQVRAAGGGMPGGALLPKVKNIILVGAGKGGVGKSTVAVNLATALAQHGAKVGLLDADFYG
PSVPLMTGLGDKRPVSPDGKVLNPLEAHGLKVMSIGFLVEADQALIWRGPMLHGALMQLVRDVNWGELDY
LVLDLPPGTGDVALTLSQSVRAAGAVLVTTPQDVALADVVRAKQMFDKVHIPVLGIVENMSQFVCPNCSHATPIFNHGGGQKAAQMFGIPFLGEIPLDLKVRVSGDSGVPVVVGAKDSPEAKAFQDVARNIAGRVSAQSAKSIPLPVMQAR

>Duf59.NBP35_corCor Corallococcus coralloides YP_005370154
MSVSQADVMTAMSKVIDPELHVDLVKAGMVKDVRVTGDTVKLKIELTTPACPMKGKIQADAEAALKAVPGLKSFDIEWGAQVRGVAGGSGGALLPGVKNILLVGAGKGGVGKSTVAVNLATSLAQHGAKVGLLDADFYGP
SVPLMTGTADKRPVSPNGKTLDPLVAHGLKIMSIGFLVEADQALIWRGPMLHGALMQLVRDVNWGELDYLILDLPPGTGDVALTLSQSVRAAGAVLVTTPQDVALADVVRAKQMFDKVHIPVLGIVENMSQFVCPHCNKS
TPIFNHGGGHKAAEMFGIPFLGEIPLDLKVREAGDSGVPVVVGHQDSPEAKAFQEVARAVAGRVSTQSMKSVPLPVMQAR

>Duf59.NBP35_stiAur Stigmatella aurantiaca YP_003953960
MSVSERDILAAMSKVVDPELHVDLVKAGMVKDIRISGDAVKLKIELTTPACPMKGKIQADTEAALKAVPGLKSFELEWGAQVRATGGGVGQGQGQALLPGVKNIILVGAGKGGVGKSTVAVNLATALARHGAKVGLLDAD
FYGPSVPLMTGITEKPVSPDGKTLTPMSKYGLKIMSIGFLVEPDQALIWRGPMLHGALMQLVRDVNWGELDYLILDLPPGTGDVALSLSQSVRAAGAVLVTTPQDVALADVVRAKSMFDKVHIPVLGIVENMSQFICPNC
SHATNIFHRGGGRKAAEMFSIPFLGEVPLELKVRESGDAGVPVVAGAPDSREAQAFLEIARNVAGRVSAQSVRSIPLPVMQAR

>Duf59.NBP35_anaThe Anaerolinea thermophila YP_004174446
MASAVTKEAVLQALSHVQEPELHKDLVTLGMVRDVEIEAGKVRFRIVLTTPACPLKSRIENEARSAVLSLSGVQEVEVILDAQVPSDGRNRGVLSLPVRNVVAVASGKGGVGKSTVAVNLAVSLAQSGARVGLLDADIYG
PNIPTMMGVQRLPPQNGQKLIPAEAYGVQVMSIGFLVKPGQPLIWRGPMLHSAIRQFLADVAWNELDYMIVDLPPGTGDAQLSLAQSVPLSGGVIVTLPQRVSQEDAMRGLQMFRELNVPVLGVIENMSYLELPDGTRMD
IFGTGGGEDLAQAAEVPFLGAIPIDPGVRVGGDQGVPVVISAPQSAPARALTAIAQKIAASLSVAALSAPGTLSINVIE

>Duf59.NBP35_anaSpp  Anaeromyxobacter sp. YP_001379317
MPLDPTTALDALRKVMDPELRRDLVSLGMVKDVVVEGDTVRLKVELTTPACPLKDTIGRDVKAALEGAGFRSVELSWGAQVRAAPGAAQGQLTPGVKNIILVGAGKGGVGKSTVAVNLAAGLARTGAKVGILDADIYGPS
VPMLTGVTDRPTSRDGKKLEPLHAHGMKVMSIGFLVDPDQALIWRGPMVTGALIQLLRDVNWGDLDYLVLDLPPGTGDIPLTLAQNVRAAGVVLVSTPQDLALADVIRAKLMFDKVSIPVLGIVENMSAFVCPHCRSETA
IFDKGGARTAAEKMGIRFLGDVPIDLAIREGGDKGVPVVVGQPDSPQAAALLAVAKNVAGAVSTQVLKAPRLPVIGAQPRA

>DUF59.NUBPL.Duf971_synSpp Synechococcus sp. YP_380733 Cyanobacteria
MTPVEQANKALQQVKDAGSGKTALELGWIEQIRITPPRAVFRLSLPGFAQSQRDRIVAEARGALMALDGIEDVQIEIGQPPSQGGIGQAGHGQPAERQSI
PGVRQVIAVSSGKGGVGKSTVAVNLACALAQTGLRVGLLDADIYGPNAPTMLGVADQTPEVQGSGDQQRIVPIETCGIAMVSMGLLIDDHQPVIWRGPML
NGIIRQFLYQAEWGERDVLIVDLPPGTGDAQLSLAQAVPMAGVVIVTTPQQVSLQDARRGLAMFRQMGIPVLGVVENMSAFIPPDRPDCRYALFGSGGGA
QLASDYDVPLLAQIPMEMPVQEGGDTGRPIVINRSDSASAAEFKGLAEAVLKAVTQTV

>Duf59.NBP35_natPha Natronomonas pharaonis YP_327062 euryarchaeota
MNEETVLDRLAAVEnDPDLGDDIVSLGLVNDVNIDAETIHVDLALGAPYSPTETELAGTVRDALSELDREI
DLTASVDTGLSADEQILPDVENIIAVASGKGGVGKSTVAVNLAAGLSQLGARVGLFDADVYGPNVPRMVE
ADDQPKATEQETIIPPEKYGMKLMSMDFLVGEDDPVIWRGPMVHKVLTQLWEDVEWGALDYMVVDLPPGT
GDTQLTLLQSVPVSGAVIVTTPQKVALDDAEKGLQMFGEHDTPVLGIVENMSGFVCPDCGSEHDIFGSGG
GESFADDVEMPFLGRIPLDPAVREGGDAGRPVVLDEDDETGEALRSFTERTANMQGIVRRRQVSAADR

>Duf59.NBP35_halPau Haladaptatus paucihalophilus ZP_08044106 euryarchaeota
MDETDVRAVLRTVEDPDLGEDIVSLGLVNDVTVEDETARISLALGAPYAPHESEIANRVREALNDEGIDT
ELSARVDTQLSPEEQVLPGVKNIIAVASGKGGVGKSTVAVNLAAGLAKLGARVGLFDADVYGPNVPRMVD
ANERPRATEEQKLVPPEKFGVKLMSMAFLTGKDDPVIWRGPMVHKVLTQLWEDVEWGQLDYMVVDLPPGT
GDTQLTLLQSVPVTGAVIVTTPQQVALDDANKGLQMFGKHDTPVLGIAENMSTFKCPDCGGEHDIFGHGG
GAEFAEDHEMPFLGSIPLDPSVRSGGDEGEPIVLDDESDTGESFRTLTENVANNVGIINRRRQQQE

>Duf59.NBP35_natPel Natrinema pellirubrum ZP_08964079 euryarchaeota
MDEAAVRDRLRTVEDPELGDDIVSLGLVNDITVDGDEVAIDLALGAPYSPSESDIAAEVRETLTAEDLEP
DLTASVPDRDDLTSEDQVLPNVKNVIAVASGKGGVGKSTVAVNLAAGLSQLGARVGLFDADVYGPNVPRM
VDADEPPMATEDETLVPPEKYGVKLMSMAFLTGEDDPVIWRGPMVHKVITQLTEDVEWGHLDYLVVDLPP
GTGDTQLTMLQTMPVTGAVIVTTPQDVALDDARKGLEMFAKHDTVVLGIAENMSTFACPDCGGEHDIFGS
GGGEDFAEEHELPFLGSIPLDPAVREGGDGGKPTVLKDDDTTSDALRTITENVANNTGIVHRQAISQSRR
NEAASPDR

>Duf59.NBP35_halLac Halorubrum lacusprofundi YP_002566480 euryarchaeota
MNEADVRERLVDVRDPDLGDDIVSLGLVNDVEVDDDEIRISLALGAPFSPHESAIADDVRAALADTGLDV
ELSASIPDDLEPDEQVLPGVKNVIAVASGKGGVGKSTMAVNIAAGLSALGARVGLFDADVYGPNVPRMVS
AEERPQTDGETIVPPERFGVKLMSMDFLTGEDDPVIWRGPMVHKIITQLVEDVEWGELDYLVMDLPPGTG
DTQLTILQTLPLTGAVIVTTPQEVALDDAVKGLRMFGKHDTNVLGIAENMAGFRCPDCGGFHEIFGSGGG
KALAQEHDLPFLGGVPLDPAVRTGGDDGEPVVLEEGETADAFRVIVENVANNAGVVRRRGVSEGR

>Duf59.NBP35_halVol Haloferax volcanii YP_003536803 euryarchaeota
MDEADVRDRLRAVEDPDLGDDVVSLGLVNAVEVDGDTVRISLALGAPYSPAETDIGRRIREVLAEDGLEV
DLTAKVPTDRDPDEEVLPGVKNIIAVASGKGGVGKSTVAVNLAAGLSKLGARVGLFDADIYGPNVPRMVA
AEEAPQATQDQTIVPPEKYGMKLMSMAFLVGDDDPVIWRGPMVHQLLTQLVEDVEWGSLDYLVLDLPPGT
GDTQLSILQTLPLTGAVIVTTPQNVALDDANKGLRMFGKHDTNVLGIVENMSTFRCPDCGNRHDIFGAGG
GREFAASNDLPFLGALPLDPAVREGGDGGKPIVLEDDDETADAFRVMTENIADMVGIVQRRSVSER

>Duf59.NBP35_halXan Halopiger xanaduensis YP_004597659 euryarchaeota
MDEDAVRDRLRTVEDPELGDDIVSLGLVNDIAVDGDEVSVDLALGAPYSPTESDIAAEAREVLIEAGLEP
DLSASVPDRDDLSSDEQVLPGVKNVIAVASGKGGVGKSTVAVNLAAGLSQLGARVGLFDADVYGPNVPRM
VDADEPPMATEDETLMPPEKYGVKLMSMAFLTGEDDPVIWRGPMVHKVITQLTEDVEWGHLDYLVVDLPP
GTGDTQLTMLQTMPVTGAVIVTTPQDVALDDARKGLEMFAQHDTVVLGIAENMSSFACPDCGSQHDIFGS
GGGREFADEHDMPFLGSIPLDPSVREGGDSGKPTVLDDDSEVGESFRTITENVANNTGIVHRRSVSQSQR
AASRSDD

>Duf59.NBP35_halTia Halorhabdus tiamatea ZP_08558390 euryarchaeota Cobyrinic acid
MDEAELRELLASVEDPDLEGDIVSLGLVNDVALENGSAHIDLALGAPFSPTETTIADRVREVIGDAAPDL
AVELTASIDRDTEGDVLPGVKNVVAVASGKGGVGKSTVAVNLAAGLADRGARVGLFDADIYGPNVPRMLD
AHERPEATEDDQIIPPEKHGMKLMSMDFLLGEDDPVIWRGPMVHQTLTQLFEDVQWGDLDYLVVDLPPGT
GDTQLTLLQTVPVTGAVIVTTPQGVALDDARKGLEMFGKHETPVLGIIENMSSFKCPDCGSEHAIFGEGG
GREFADQVQMPFLGEIPLDPEIRERGDEGRPAVLADDLDVSGAFRNFVANTANNQGIVHRNRLSEQSE

>Duf59.NBP35_calSub Caldiarchaeum subterraneum BAJ47606 thaumarchaeota
MLIDEQTVLNALRQVIDPDLKIDIVTLGMIKNLVIKDGDVSFTLELTTPACPYNKSIEDSARAAVESIPG
VRSVDMRVTARVWSAKPMASTYPDVKNVVAVASGKGGVGKTTVAINLACSLALSGARVGLVDADIYGPTI
PKIVKIVEPPRLRPDKKVEPAKMMLGIKVMSLGLFVDEGTAVIWRGPLVASAVKQLLTEAQWGELDYLIV
DLPPGTGDASLTLAQTMPLTGVVIVTTPQQAASVIAAKALSMFRRLGVTIIGIVENMSYYVCPECGKESS
LFGQSHTDKMAAELDVEVLGRIPMSPDVSVNHDQGVPIVLAAPSSPAAKAFDEAAKKIAAKISILAHAAG
AAKAGAK

>Duf59.NBP35_cenSym Cenarchaeum symbiosum YP_875901 thaumarchaeota chromosome partitioning
MCGTGAHMQAPPAGPSRHGWQGFRAGSFSRIRLSLNNENTLTENMVGVDQVLESLGKVIDPDLKKDIVSMGMIKDLELDDGNLKFTLELTTPACPFNVEI
EDDVRKVIGELDGIKNLNLNVTAKVMEGRSLDEDAGMTTVKNIIGVASGKGGVGKSTVALNLALALGQTGAKVGLLDADIYGPSIPLMLGMKEAFMEVEA
NKLQPAEASGIKVVSFGFFAEQAHKAAIYRGPIISGILKQFLVDTNWSDLDYLIVDLPPGTGDIPLTLAQTIPITGILVVTTPQNVASNVAVKAVGMFEK
LNVPIIGVVENMSGFVCNKCGEKHNVFGEGGAKRISEQFKIPLIGEIPLTAGIMAGSEEGRPIILTDPDSPSSNAFRSSAKNIAAQCSIIAAKLQEEMAA
EAAASPDAGGAEGQSPPQQDAGKPLGVASAAEKDGGL

>Duf59.NBP35_nitSal Nitrosopumilus salaria ZP_10117149 thaumarchaeota
MVGIDQVLEKLSTVIDPDLKKDIVSMGMIKDLELNDGNLKFTLELTTPACPFNVEIEDDVRKAIGEISELKNFDMKVTAKVMEGRSLEADTGMASVKNII
GVASGKGGVGKSTVSLNLALALAQTGAKVGLLDADIYGPSIPLMLGMKDGFMEVEDNKLQPADSHGLKVVSFGFFADQSNQAAIYRGPIISGILKQFLVD
TNWSDLDYLIVDLPPGTGDIPLTLAQTIPITGILVVTTPQDVASNVAVKAVSMFEKLNVPIIGVVENMSHFICPNCNEKHYIFGEGGAKKISEQFNMPFL
GEIPLNSGIMAGSDLGKPIMITNPDSPSAVAFRKSAKNIAAQCSILAAKLQDEMAAESSEPTPEPTN

>NBP35_pyrFum Pyrolobus fumarii YP_004781840 no Duf59_NUBPL in crenarchaeotes, most like NUBP1
MRVLVVSDALVKQRAEIMKKVIEQQRMIAEKMKKVRYKLVILSGKGGVGKSFVTASLAMALAMKGRRVAVFDADVHGPSIPKMLGVHGKRMYALPDGRLLPVEGPLGVKVVSIDFLLESEEQAVIWRGPLKTAAIRELLA
YTDWGELDYLLVDLPPGTGDEQLTIAQLIPGLSGTIIVTIPSDVARIVVKKAITFAKRLNIPIVGVIENMSYFECPDGSRHYIFGKGAGRRIAEEMGVPFLGEIPIDPRISKANDEGKPFFVEYPDSSAAKAFLEIAERVIERVEGKGEGRSESQAKE

>NUBPa_arcFul Archaeoglobus fulgidus NP_071094 3KB1
MQKRVTDEDIKERLDKIGFRIAVMSGKGGVGKSTVTALLAVHYAKQGKKVGILDADFLGPSIPHLFGLEKGKVAVSDEGLEPVLTQRLGIKVMSIQFLLP
KRETPVIWRGPLIAGMIREFLGRVAWGELDYLLIDLPPGTGDAPLTVMQDAKPNGAVIVSTPQELTAAVVEKAITMAEQTKTAVLGIVENMAYFECPNCG
ERTYLFGEGKASELARKYKIEFITEIPIDSDLLKLSDLGRVEEYEPDWFEFFPY

>NUBPb_arcFul Archaeoglobus fulgidus NP_071205 2PH1
MQKRVTDEEIKERLGKIKSRIAVMSGKGGVGKSTVTALLAVHYARQGKKVGILDADFLGPSIPILFGLRNARIAVSAEGLEPVLTQKYGIKVMSMQFLLP
KENTPVIWRGPLIAGMIREFLGRVAWGELDHLLIDLPPGTGDAPLTVMQDAKPTGVVVVSTPQELTAVIVEKAINMAEETNTSVLGLVENMSYFVCPNCG
HKSYIFGEGKGESLAKKYNIGFFTSIPIEEELIKLADSGRIEEYEKDWFESAPF

NARFL (IOP1)

(coming shortly)

ERCC2 (XPD)

(coming shortly)

Curated reference sequences

It serves no current purpose to collect all possible full length MMS19 sequences from GenBank, so only a sample of 20 uniformly distributed over the eukaryotic phylogenetic tree is provided here. MMS19 presents no real homology complications, being present as a single-copy gene. Genes in early diverging eukaryotes are assumed single-exon, ie taken as the largest open reading frame enveloping the match to the ultra-conserved region. MMS19 is studied experimentally only in yeast and human.

The apparent absence in Giardia and various obligate parasites could be attributable to a reduced genome, extreme sequence divergence relative to available probes, or incomplete assembly -- it is inconceivable that these species lack core iron sulfur proteins of DNA metabolism. Indeed, the conserved cysteine pattern of primase large subunit are readily located in these species. It remains conceivable however that the very earliest diverging eukaryotes retain components of the archaeal iron sulfur cluster formation system.

The yeast gene, sometimes called MET18 in that literature, is unsurprisingly single-exon (only 283 of 6000 yeast proteins have them) and not located in a yeast-type operon. While some immediate neighbors are involved in DNA processes, none are homologous to iron sulfur cluster assembly components or have recognized 4Fe-4S cofactors themselves.

Gene   Position      Description

MET18  chrIX:113806  DNA repair, TFIIH regulator, nucleotide excision repair, RNA polymerase II, telomere maintenance
RRT14  chrIX:117024  rDNA transcription, localizes to nucleolus, involved in ribosome biogenesis
STH1   chrIX:117992  ATPase component in chromatin remodeling, expression of early meiotic genes, helicase-related protein homologous to Snf2p
KGD1   chrIX:122689  mitochondrial alpha-ketoglutarate dehydrogenase
ASG1   chrIX:102782  zinc cluster transcriptional regulator stress response
CSM2   chrIX:99860   homologous recombination repair, accurate chromosome segregation during meiosis
SIM1   chrIX:128151  may participate in DNA replication

The human gene has 31 coding exons. These do not correspond to natural structural breaks in the tertiary structure (eg HEAT units) and the ultra-conserved regions is spread across parts of 3 exons. Thus despite its modular structure, MMS19 had already completed its internal expansion of domain units prior to the main era of exon formation and could not today expand further by exon duplication because these would present issues of compatible [phasing] as well as not corresponding cleanly to structural units.

Exon structure of human MMS19: columns show exon number, amino acid size, intron phasing (donor bp overhang), primary sequence, and ultra-conserved region.

1   37  1  MAAAAAVEAAAPMGALWGLVHDFVVGQQEGPADQVAA
2   17  2  DVKSGNYTVLQVVEALG
3   33  1  SSLENPEPRTRARAIQLLSQVLLHCHTLLLEKE
4   29  0  VVHLILFYENRLKDHHLVIPSVLQGLKAL
5   25  0  SLCVALPPGLAVSVLKAIFQEVHVQ
6   23  1  SLPQVDRHTVYNIITNFMRTREE
7   43  1  ELKSLGADFTFGFIQVMDGEKDPRNLLVAFRIVHDLISRDYSL
8   21  0  GPFVEELFEVTSCYFPIDFTP
9   29  0  PPNDPHGIQREDLILSLRAVLASTPRFAE
10  25  0  FLLPLLIEKVDSEVLSAKLDSLQTL
11  26  0  NACCAVYGQKELKDFLPSLWASIRRE
12  46  1  VFQTASERVEAEGLAALHSLTACLSRSVLRADAEDLLDSFLSNILQ
13  52  0  DCRHHLCEPDMKLVWPSAKLLQAAAGASARACDSVTSNVLPLLLEQFHKHSQ
14  26  1  SSQRRTILEMLLGFLKLQQKWSYEDK
15  42  1  DQRPLNGFKDQLCSLVFMALTDPSTQLQLVGIRTLTVLGAQP
16  28  2  DLLSYEDLELAVGHLYRLSFLKEDSQSC
17  33  1  RVAALEASGTLAALYPVAFSSHLVPKLAEELRV
18  50  1  GESNLTNGDEPTQCSRHLCCLQALSAVSTHPSIVKETLPLLLQHLWQVNR
19  52  1  GNMVAQSSDVIAVCQSLRQMAEKCQQDPESCWYFHQTAIPCLLALAVQASMP
20  34  2  EKEPSVLRKVLLEDEVLAAMVSVIGTATTHLSPE
21  34  0  LAAQSVTHIVPLFLDGNVSFLPENSFPSRFQPFQ
22  23  0  DGSSGQRRLIALLMAFVCSLPRN
23  42  1  VEIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPA
24  34  0  GQQLDEFLQLAVDKVEAGLGSGPCRSQAFTLLLW
25  19  0  VTKALVLRYHPLSSCLTAR
26  62  1  LMGLLSDPELGPAAADGFSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPQ
27  28  0  DVKPNYLKGLSHVLNRLPKPVLLPELPT
28  55  0  LLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSM
29  20  0  AVRIAALQCMHALTRLPTPV
30  34  2  LLPYKPQVIRALAKPLDDKKRLVRKEAVSARGEW
31   9  0  FLLGSPGS*
Alignment of ultra-conserved region:

MMS19_homSap   FTFGFIQVMDGEKDPRNLLVAFRIVHDLI-------SRDYSLGPFVEELFEVTSCYFPIDFTPPPNDPHG-IQREDLILSLR
MMS19_musMus   FTFGFIQVMDGEKDPRNLLLAFRIVHDLI-------SKDYSLGPFVEELFEVTSCYFPIDFTPPPNDPYG-IQREDLILSLR
MMS19_cioInt   FLYQYIQVIDGEQDPRNLLTIFQLTKNLI-------ESSFPLFDLVEELFDVSSCYFPIDFNPAAAGKKSTITNLDLVSSLR
MMS19_braFlo   FVWGFIQAMDGEKDPRNLIIAFSIAR-IV-------AQAFPIGTFTEELFEVISCYFPIDFTPPADDPHG-VTREDLVLGLR
MMS19_strPur   FVLGLLHAMDGEKDPRNLILLFNILP-TV-------INNFKIDMFIEETFEVVACYYPVDFHPPPNDPYG-ISREKLALSLK
MMS19_sacKow   FVFGYIQCMDGEKDPRNLTMIFRCVP-II-------IHNFPIDVFIEELFEVVSCYFPIDFTPPPNDPYK-VTQEELVLGLR
MMS19_dapPul   FVFGLIQLADQERDPRNLLILFSIFPVVA--------RYFRFEPFTEEFFEVFSCYFPIDFTPPANDPYA-VTKEQLCDGLR
MMS19_droMel   FVYGLINSIDGERDPRNLDIIFSFMPEFL--------STYPLLHLAEEMFEIFACYFPIDFNPSKQDPAA-ITRDELSKKLT
MMS19_nemVec   LVFGFLQAMDGEKDPRNLVVAFKLAR-II-------IKNFPIGLFAEDLFEVTSCYFPIDFTP-------------------
MMS19_triAdh   FVFGYIQVMDGEKDPRNLLLALKIAKFIV--------QNFNIDLFLDDFFEIISCYFPIDFTPPPNLP----SNENVTK---
MMS19_sacCer   FIETFLHVANGEKDPRNLLLSFALNKSIT-------SSLQNVENFKEDLFDVLFCYFPITFKPPKHDPYK-ISNQDLKTALR
MMS19_schPom   FFSGICSTFAGEKDPRNLMLVFSMLK-KI-------LSTFPIDGFEQQFFDITYCYFPITFRAPPDATNLAITSDDLKIALR
MMS19_araTha   LVYAMCEAIDGEKDPQCLMIVFHLVELLAPLFP---SPSGPLASDASDLFEVIGCYFPLHFTHTKDDEAN-IRREDLSRGLL
MMS19_dicDis   FMVGYLQFIDNEKDPRNLIFSFKLLPKVIYNIP---EHKHFLES----LFEIISCYFPISFNPKGNDPNS-ITKDDLSNSLL
MMS19_pytUlt   FAQAFLNAMEGEKDPRNLLLCLQIARELLAKLE---VVFDRHDAVLQQYFDVVSCYFPITFTPPPNDPYG-ITSEELILSLR
MMS19_sapPar   LMDGFLRAMSGEKDPRNLLFCLRFAAELLTTYA---NVVDAD--VAKGFFDATSCYFPITFRPPPNDPYG-ITSEDLVLALR
MMS19_polPal   FMAGFLQFIDGEKDPRNIIYTFRLIPRVILYIP---EYKNFADS----LFEILSCYFPISFNPKPGDPNS-ITKDDLVSSLL
MMS19_entHis   -IDTCVQLIELERDPECLKEVFDLIKLVS-------QKNEIDADSAPLLFDCASAYFPILYPPKGDEA----LRIDLTNKIL
MMS19_naeGru   FLNGFIQSLEGERDPGNLLYCFNLIPKVIAIFDDSELSSKILSAVSDDLFDITSCYFPITYTPPANDTRG-ITREDLSRSLK
MMS19_phyInf   LAQTFLSAMEGEKDPRNLLLCMQVARTLLSKLE---PVFSRSDTLLQQYFDVVSCYFPIIFTPPPNDPYG-ITSEGLILSLR
MMS19_albLai   FIRSFLNAMTGEKDPRNLKHCFQIAQTMMQKLE---MVFQEAE-LSEQYFRVISCYFPITFTPPPNDPYG-VTTEELIRSLR
Consensus      f  g  q  dgEkDPrnL   f                          lF#v sCYFPI ftpp ndp   it edl   lr
Summary of MMS19 reference sequences:

MMS19_homSap Homo sapiens mammal Q96T76 1030 aa 7 HEAT 100%
MMS19_musMus Mus musculus mammal Q9D071 1031 aa 9 HEAT 89%
MMS19_cioInt Ciona intestinalis urochordate XP_002128657 1026 aa x HEAT 32%
MMS19_braFlo Branchiostoma floridae cephalochordate XP_002588594 1027 aa x HEAT 42%
MMS19_strPur Strongylocentrotus purpuratus echinoderm XP_001194909 975 aa x HEAT 36%
MMS19_sacKow Saccoglossus kowalevskii hemichordate XP_002735310 1007 aa x HEAT 40%
MMS19_dapPul Daphnia pulex crustacean EFX86854 961 aa x HEAT 38%
MMS19_droMel Drosophila melanogaster insect NP_649519 959 aa x HEAT 30%
MMS19_nemVec Nematostella vectensis cnidarian XM_001629116 897 aa x HEAT 32%
MMS19_triAdh Trichoplax adhaerens single-celled metazoan XP_002114595 959 aa x HEAT 39%
MMS19_sacCer Saccharomyces cerevisiae budding yeast P40469 MET18 1032 aa 13 HEAT 29%
MMS19_schPom Schizosaccharomyces pombe fission yeast Q9UTR1 1018 aa 14 HEAT 25%
MMS19_araTha Arabidopsis thaliana plant NM_124186 1134 aa x HEAT 28% armadillo/beta-catenin-like
MMS19_dicDis Dictyostelium discoideum slime mold Q54J88 1115 aa 18 HEAT 31%
MMS19_pytUlt Pythium ultimum stramenopiles ADOS01001616 957 aa 31%
MMS19_sapPar Saprolegnia parasitica stramenopiles ADCG01000470 804 aa 31%
MMS19_polPal Polysphondylium pallidum amoeba EFA86574 994 aa x HEAT 28%
MMS19_entHis Entamoeba histolytica amoeba XP_651925 868 aa x HEAT 25%
MMS19_naeGru Naegleria gruberi early eukaryote: heterolobosea XP_002678884 1070 aa x HEAT 27%
MMS19_phyInf Phytophthora infestans early eukaryote: stramenopiles 1114 aa x HEAT 33%
MMS19_albLai Albugo laibachii early eukaryote: stramenopiles 1077 aa x HEAT 27%
>MMS19_homSap Homo sapiens mammal Q96T76 1030 aa 7 HEAT 100%
MAAAAAVEAAAPMGALWGLVHDFVVGQQEGPADQVAADVKSGNYTVLQVVEALGSSLENPEPRTRARAIQLLSQVLLHCHTLLLEKEVVHLILFYENRLK
DHHLVIPSVLQGLKALSLCVALPPGLAVSVLKAIFQEVHVQSLPQVDRHTVYNIITNFMRTREEELKSLGADFTFGFIQVMDGEKDPRNLLVAFRIVHDL
ISRDYSLGPFVEELFEVTSCYFPIDFTPPPNDPHGIQREDLILSLRAVLASTPRFAEFLLPLLIEKVDSEVLSAKLDSLQTLNACCAVYGQKELKDFLPS
LWASIRREVFQTASERVEAEGLAALHSLTACLSRSVLRADAEDLLDSFLSNILQDCRHHLCEPDMKLVWPSAKLLQAAAGASARACDSVTSNVLPLLLEQ
FHKHSQSSQRRTILEMLLGFLKLQQKWSYEDKDQRPLNGFKDQLCSLVFMALTDPSTQLQLVGIRTLTVLGAQPDLLSYEDLELAVGHLYRLSFLKEDSQ
SCRVAALEASGTLAALYPVAFSSHLVPKLAEELRVGESNLTNGDEPTQCSRHLCCLQALSAVSTHPSIVKETLPLLLQHLWQVNRGNMVAQSSDVIAVCQ
SLRQMAEKCQQDPESCWYFHQTAIPCLLALAVQASMPEKEPSVLRKVLLEDEVLAAMVSVIGTATTHLSPELAAQSVTHIVPLFLDGNVSFLPENSFPSR
FQPFQDGSSGQRRLIALLMAFVCSLPRNVEIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPAGQQLDEFLQLAVDKVEAGLGSGPCRSQAFT
LLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAAADGFSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPQDVKPNYLKGLSHVLN
RLPKPVLLPELPTLLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAALQCMHALTRLPTPVLLPYKPQVIRAL
AKPLDDKKRLVRKEAVSARGEWFLLGSPGS*

>MMS19_musMus Mus musculus mammal Q9D071 1031 aa 9 HEAT 89%
MAAATGLEEAVAPMGALCGLVQDFVMGQQEGPADQVAADVKSGGYTVLQVVEALGSSLENAEPRTRARGAQLLSQVLLQCHSLLSEKEVVHLILFYENRL
KDHHLVVPSVLQGLRALSMSVALPPGLAVSVLKAIFQEVHVQSLLQVDRHTVFSIITNFMRSREEELKGLGADFTFGFIQVMDGEKDPRNLLLAFRIVHD
LISKDYSLGPFVEELFEVTSCYFPIDFTPPPNDPYGIQREDLILSLRAVLASTPRFAEFLLPLLIEKVDSEILSAKLDSLQTLNACCAVYGQKELKDFLP
SLWASIRREVFQTASERVEAEGLAALHSLTACLSCSVLRADAEDLLGSFLSNILQDCRHHLCEPDMKLVWPSAKLLQAAAGASARACEHLTSNVLPLLLE
QFHKHSQSNQRRTILEMILGFLKLQQKWSYEDRDERPLSSFKDQLCSLVFMALTDPSTQLQLVGIRTLTVLGAQPGLLSAEDLELAVGHLYRLTFLEEDS
QSCRVAALEASGTLATLYPGAFSRHLLPKLAEELHKGESDVARADGPTKCSRHFRCLQALSAVSTHPSIVKETLPLLLQHLCQANKGNMVTESSEVVAVC
QSLQQVAEKCQQDPESYWYFHKTAVPCLFALAVQASMPEKESSVLRKVLLEDEVLAALASVIGTATTHLSPELAAQSVTCIVPLFLDGNTSFLPENSFPD
QFQPFQDGSSGQRRLVALLTAFVCSLPRNVEIPQLNRLMRELLKQSCGHSCPFSSTAATKCFAGLLNKQPPGQQLEEFLQLAVGTVEAGLASESSRDQAF
TLLLWVTKALVLRYHPLSACLTTRLMGLLSDPELGCAAADGFSLLMSDCTDVLTRAGHADVRIMFRQRFFTDNVPALVQGFHAAPQDVKPNYLKGLSHVL
NRLPKPVLLPELPTLLSLLLEALSCPDSVVQLSTLSCLQPLLLEAPQIMSLHVDTLVTKFLNLSSSYSMAVRIAALQCMHALTRLPTSVLLPYKSQVIRA
LAKPLDDKKRLVRKEAVSARGEWFLLGSPGS*

>MMS19_cioInt Ciona intestinalis urochordate XP_002128657 1026 aa x HEAT 32%
MEKVKFEMEEMIQLWLRDKNDDHKILKCAQQIENREQTIGDLVTALGPHLTNKDTKIRIDACTLLSNVIHKLPKDCLNQGELESLVQFLCSRLEDHYTLQ
PVALSLLLQLSSADNLTGENACSIITSVFKEVHIQTCMQHDRLKIFQILGTLLDIHTKDVITMGRDFLYQYIQVIDGEQDPRNLLTIFQLTKNLIESSFP
LFDLVEELFDVSSCYFPIDFNPAAAGKKSTITNLDLVSSLRGVLASTKQFAQYCIPLMLEKLESDVESAKIDSLETLTACLGCYGKQELEKYLSSLWSDV
KREINQSSSEQIEKCCLTFLTSLLSNLSSWPVDQKSEKATDLKSFLDDVLEDCVPRLQAQSDDRSKWMAGHVVLACAKSSKKACSQIVTTVLPILLQNAQ
SKSASTTLAGQSVQQSALDNLVKLTAVCGQFNFENHPVLKKKEEFFTILNELALKSEIEEQLKCIAVAGFASLLKLEILSNVELTEIASLLLKMIKLKPE
SHLRGEVLSVAGYLSSQHPDVAKSHLIPCVMRRMEEGDDSCFDVLASVCTHFDVLKLVLGFIMERIVNTQVDETSEPLLHACLESLQKMTSSSWVGNTEI
EYMALNLVLPLLKRCIEVTLELSVPEQCCANCHIFEDVSKECASLPILKSAAIVIRNVCQKLKPGKSTDLVIQLIASLYNNSKLSSLDIKSDVHFTPFHP
KASPLQTRTLCFLPATICALHPNIEIPELAELETKLLNTCLHCTDQPSYVFAAKALSGLVNKYKKPSIPILEKLKSHFDTDPNWSLKSEEEKMMILTLLI
WICKALVLSNHPDSLIFIKNLLYWMGDDSVGEVAAAGFDIILRESNEVLSPSSHSTIRLMHKQRFFLLIIPEIVSSFKTSENKTQQTNILTALSHLIGHL
PKQVLMQHFTELLPLLTQALHTDNTQLLKSVLSTLFCFIQDTTEAMTAHLENLMKHFLRLSKFKQDIDVRVKAVQCIGVVTLLPPIVILPFKNDIVRHLV
SVLDDRKRDVRTEASKARSEWFLVGT*

>MMS19_braFlo Branchiostoma floridae cephalochordate XP_002588594 1027 aa x HEAT 42%
MAALSGNVQENVLEFVQGQQDSALQSVAKAVFDGETSLLQLVESLGSSLTSTEVTTRARATQLLAEVLHRSPSNRLTEKEAEVLSAFFCDRLLDHHSVQP
HVLHGLLALSAAPQLPQGEEVKIVQVIFKEVYVQSLVQTDRRAIYNILANFLDTRLEALQALGADFVWGFIQAMDGEKDPRNLIIAFSIARIVAQAFPIG
TFTEELFEVISCYFPIDFTPPADDPHGVTREDLVLGLRQVLAATSKFAQFCVPMLLEKLSSDVTSAKLDSLHTLAACAEVYGADSMKSFLDLLLSAISKE
VYSSIHQDVENAALAGLTAVVATLSHAVTETRSVFSLHHFLDSLLKGCKHHLCEPELKLMWPSAKLLQAAARASDPACVHVLDTAVPLLVEQFQVHPYPQ
HRHTILEVTIAFIHVAHASTSGTDAPNPVVPHSDNFLTLFYSVLEDADAGLRSSGVGGMAAMIGITDVVKGKHLDLCANHLGRLVLHDADPTVQRRSTEA
LAAMATAHPDVVREEVLSKLLQVLENNNPNAMDTNQSEQVCAKHVTNQYVLNTLAAVSTHPTIVRCTIPKLLSHLQALIESCPDQATQEAIATLDCVYKV
VEKTVINDANVEYFVDTIVLNLMSMALSAAVNTSDENLLHDTSLLEIVAKVLRAVARSLPNSTGKGIVNSTVQAFLQGNLAAISLNTSASFEPLDVSSPW
QQTQTVQLLSAIVCSVARNVDIPSISELAQKLLTLSCASDHEPTSLAAAKSLSGVVNKWDQGEQLQTFLQETRDCLEQILSKTEDEKARCRAVAVLVWLT
KALVIRGHPSGSQFTKTLMALFEDEAIGRRAAEGFYVILSDSPDVLSKESHANIRLMYKQRFFMENLPALVDGFNQADDGRKQSFLCAVSHLLTFIPRQV
LLGALPPLVPLLVQSLLGEDPSLQVSTLEMFSSLVQEAPQVISKNIDALIPQLLELSKNGPTMKVRMAALKSVGSMTSLPHAVVYPYRNRVVRELAVAVG
DKKRMVRKEAVAARGEWFLLGSPGGK*

>MMS19_strPur Strongylocentrotus purpuratus echinoderm XP_001194909 975 aa x HEAT 36%
MGTYLMSTETRIRAKGVELMSEVLTSLPRAFLNQQQIQVLIEFLCARLLDHHSITQHTLKGLLAMSSQSSFPPSSSVQVMTAIFKEVQVQTMLQVDRRTV
YNIVVNLLRISLTELQGMGSEFVLGLLHAMDGEKDPRNLILLFNILPTVINNFKIDMFIEETFEVVACYYPVDFHPPPNDPYGISREKLALSLKTCLSST
PKFAQFCLPMVMEKLSSDLQTARLDSYQLLQACAPVYSQGDMMSYIEAIWSYCRKELMVGASVELDQEAVKTLGAVVKAVSTGIQSTSGGGGGDGDLNSF
LRNILTECRQHLCKPDHRMIHPCSKLLVAVATASYPACIAILKYSVPILLDQFHIFDQTRERMVLLDIIQRLLHSGHDHIKEADDWRAIYAHHLDTVVTT
VLSTLAKDQGVPDLRMAGLGTLGELVQVPVLMDQSRLELVGQELTRILLEEANEDVRCECIETVSCFASRHTEFVKSTILTTLWTTVQKGESGYQRIVVD
MATIVTDTSDDLSRSLTSELMVEIAKTELNSEQHLVYLATLNTLTAHLSSAPSNLESLLSSVVHPLMKMVVSATLQSSVEAGNNPHCCGEVLVAMAEVFR
TVIPKLDSSMGSKLCQCAVDVFLHGNLTSLELTNPNTSVPFSPLDPRAPVHQTQLVTVLQPIVCSLRRDIHIPSSKQLMSSLLHIAAHSRAWLASTWAAK
GLAGGVNKHPAGSDLDEVLVEAESLLGQAMSSGQEGSVKQQALMAWVLLTKALVMRSHPKATAFLTTLLRLLEDAELGAQVPQTLGMLLEDMRDVLSEGL
HADVKIMYKQRVFLQALPFVMALFNKDDLRTKAITALCHLLPSIPRPVLLAELPPIIPRLVQSLRVTDPRPTLPILDILESLLEETLPSLVDQADTLLPT
LLELSAYQASMKVRIASLKCVGAITSFPHHLVYPHQETVVRSLAPRLDDKKRLVRQEAGKARTKWILLQQDTKG*

>MMS19_sacKow Saccoglossus kowalevskii hemichordate XP_002735310 1007 aa x HEAT 40%
MATSMCIEIVENYVRGEDESAIHAAEIKILELVENLGTYLTSTEKNIRCRGTRLLSEVLNRLPKNFLSSDEVRALVIFYCDRLSDHYSVTPHTLLGMLAL
STYDNLPKGCEVQLVQAIYKEVHVQSMIQVDRRSVYAILSNLLDTRIKDLQSLGRDFVFGYIQCMDGEKDPRNLTMIFRCVPIIIHNFPIDVFIEELFEV
VSCYFPIDFTPPPNDPYKVTQEELVLGLRKCLAATPKFAEHCLPLLMEKLSSDVQRAKIDSFLTLAECCEVYGEDDLMEFLPAMWSTIRREVFQAFSHEV
EKSALTCLCSIVKTLSNAVSNANKAAGGLDEFLDLVLKDCSKHLRDPGLRLMLPTSKLLQSAASASDPACYKIISAVVPILLEQFHKCKQVNERVSLLHA
ALDFIKVCKSFTFGDDTPSPVIPFKDSLASLFLSLLSDHSSQLRCIGITGLVGLMSLNAIMNINEKKLAAMHFTNIVLTDQDNKVCSEAVTALAFMSMEF
SLLVKEEVLPQLIKELDSRATGTRHRFIVNTLAGISMHSDIVLTTIPVMLQHLGTLSEDNTAESLETAVNTIQSIDIVVNSNISDEQCLDFFHSKLLPQL
LRITVDQALQVNNYILCKEDVVSSIATVCRNIAKVLDDRVASNLVSNTISLFLDGNLENIGLKQSSQHFRPLEISSPWQHTQLVSLLTSIICSMKTFELS
SQCLELMEKLLKLSLSSEHHLTCVSAAKCYAGLVNKHKQGTDLDSSLETVVESTCRMLQDEISDQNIYNRQKALTLWLWVTKALVLRAHFKSTQFTTKLI
SLFEDHQLSQMAADGFYIILSESQDVLNKDMHCDIKLMYRQRLFMQTLPRILAGFEKANEDKKQYYLSALSHLLQFIPKQVLLSELPPLMPMLVQSLYCQ
DVGLYVSTSDTLSMLIQDAPTVISLYVDTLLPQLLTLSTYQQSMKVRIAALKCIGLFVTLPTHVIYPRQKEVVRRLASVLDDRKRLVRQQAVTARGLWFL
LEAPKK*

>MMS19_dapPul Daphnia pulex crustacean EFX86854 961 aa x HEAT 38%
MAISTAIQKLRDSFNSEESANESIRCISQSIASKELTILKLVEDLQPDLLNQQNTHRCKAVSTIGTILEQLGPELKGLNEKEVELVTEFFCSKLKDHHSI
LPAALQGLHALSTAPKLSPGLARLISQSIFQDVHCQSQLQHDRRAIYKTLKNLLAFHLKELQDLGQDFVFGLIQLADQERDPRNLLILFSIFPVVARYFR
FEPFTEEFFEVFSCYFPIDFTPPANDPYAVTKEQLCDGLRQCLAGSPHFAEYCLPLLQEKLESDLVSAKVEALKTLELCCQTYQAGQLEKWVDSFWTGIR
REVLINVNTDDLEHASLDALAALSRAFTTDGEFNSPAFTKLLKNVLTECQGHLCEPERRLMTPSSYILLAICSGSAPACALIVSQVIPLLMDQYRIRPQS
NPRQFILNSLNKMVHAGLYGFTEENVAQSGLASLIPKLLELYLEVLKEDDAVLRNLSLQGLSHLIGTCLNHQDLEKVNGTLLDLLQKSTATDSVIAEIGH
FFCKSAEKNENLFLEQVLVKLLDIAVSGSIPTDGCARTIRPGITTGSTQSFDSFRTKGRTRNIPAIAPLGIENIGRRRSSGVTPSHLCLIEKSGFQFIFR
VILLDQNVGRNVFVTFSALYRKATEFINEQTEQYVSQHLARSPWTLSIMEATLGSLDATPSGHSLERLVNTLEPLTVCHPKADVRLSACRLMAALVNKLP
EGHELEAILDSLRRKWQDPSTDRCNSVCLFVWITKALLMRSYSKLNQYIQELVDSLNDPTHGYQVAEGFKTILCDTEECLNFNCHANIRLMYRQRFFQEV
VPRLLKLYRESESCNKAACFAAIANQLAFIPEGVLIAHITTLIPLLIQCLSTDQPAQLIISTINAFMGLMSDNVSAIEEYISSLVPRLLTLAKDGITMDV
RRLALQCLSELRKAQSIVLLPLRSEVILRLVPCLSDKKRLVRREAALARQKWIMLGQPGCN*

>MMS19_droMel Drosophila melanogaster insect NP_649519 959 aa x HEAT 30%
MTTPTRATLEKALKSDQKLVNSATQIAKDLTAKAYDISALAEALGFALSSPDMEERVAGTNLLSAVLIALPQDLLQERQLEFLSTFYMDRLRDHHNVMPA
IIDGIDALVHMKALPRAQIPQILQSFFEHTTCQSQTRSDRTKLFHIFQYLTENFQDELQAMAGDFVYGLINSIDGERDPRNLDIIFSFMPEFLSTYPLLH
LAEEMFEIFACYFPIDFNPSKQDPAAITRDELSKKLTNCLVANNEFAEGTVVLAIEKLESELLVAKLDSIELLHQAAVKFPPSVLEPHFDQIWQALKTET
FPGNDNEEILKASLKALSALLERAAHIPDISHSYQSSILGVILPHLSDVNQRLFHPATGIALVCVSGDAPYAADKILNSFLLKLQAADASSEQRIKIYYI
VSQVYKLSALRGSLQKLDTTIRESVQDDVIASLRLIEQEEFDAKKEDLELQKAALSVLNESAPLLNEKQRALIYKALVQLVSHPSIDIDFTTLTVSLGAL
QPVEVQSNFIDVCVRNFEIFSTFVKRKIYTNLLPLMPQIAFTQRILDLVMTQTFNDTTAEPVRLLALEALNKLLLLADQRFIVDVQQESNLLHKLIELGQ
KTEGLSMQSLEQIAGALSRITQQLPLSEQSAIVSEYLPGLNLSQSADLYITKGLLGYLHKDITLDDHFERLLTDLTQLSLNSDNEQLRVIAHHLLCSMVN
KMESNPANLRKVKKITEQLKVAIKKGDVRAVEILAWVGKGLVVAGFDEAADVVGDLSDLLKHPSLSTAAALGFDIIAAEYPELDLPVVKFLYKQKLFHTI
MGKMGSKLANYCVHHLKAFVYVLKATPQAVIKLNIEQLGPLLFKSLEEHNEAQSLCIALGICEKFVAQQDTYFQGHLAHLIPSCLELSKYKAQHTMQVRI
AALQLLYDVTKYPTFVLLPHKVDVTLALAAALDDPKRLVRNTAVKARNAWYLVGAPSPN*

>MMS19_nemVec Nematostella vectensis cnidarian XM_001629116 897 aa x HEAT 32%
MAALGQEEYPSLATLLQDVYQRRKNLLQVVELLGPSLTSTDTDKRCSAVQLLSSLLQKLVNYKLTDREDLKPVGSDLVFGFLQAMDGEKDPRNLVVAFKL
ARIIIKNFPIGLFAEDLFEVTSCYFPIDFTPFCLPLLMEKLSSDVINAKIDSLLTLVFQTVSSELEDAAFKALSSIIKNLESSSPGQEPFLSRIFINFYT
ISCYVTQCHPDVVEFKTPFLDCVIKECCANIEGADLRKVKPSGQLLQAAFVTDTTYNEITSTAVPLILSKYNDEATQGLVKKLLLDVLLGLLTASKPYYK
RKGSVLASHTSALVDVLFSALVSDSPSLCRAAIAGLVSMVTLPGLLLEQKVGMFVEHLTSFVLNTKDLTVRQESNAALAFLAMEFPELIKTKLVSVLAEQ
LQKEDGSAMDEENISHLQSDKSHPQYDQMLNTLSAVCTEEGVVRHVVPIILDHGEYLVTGKDLERGVLHGKISETLKCLNSIVKGTLQSSTVEPNYYTEV
VIYRIIDLCTQSALQESPDCPMATPEALALVCSIVRQVISHLAVNEAEDVLHIIVSNFIEGKTPLSARAEQKFAPLEPSSPWQQSQLVTVLMAAVCSARR
EVRIPRQKELVPRLQVLASGCNHRKTTVAASKCLGGIINKMAQGDDLTADLHSLKGQLQNHMDGNEEQRWRAVITWLWLTRALVTRSHPMAQEFVQKVLH
LLDDVSVGRVAADGFYVIVSDCDDVMNQAMHADIKMMYKQRFFMETLPLLLKGFHDTRPECKYLYLCALSHLLQWIPKQVLLTEIPTLMPMLIQALSRDE
PSLLLSTLQTLYSLVFDAPEVISRQVTSLIPNFLELAKCKASMKVRMEAIKCLGAMTTLEHHVVYVYKARVIKELACTLDDPKRLVRAEAVKCRNEW*

>MMS19_triAdh Trichoplax adhaerens single-celled metazoan XP_002114595 959 aa x HEAT 39%
MEKDSSAKSLQQLMDEFILGNSSAINEIIKGIYDGHIKLSTIVELLGPYLTSVEHEKRLQGMKLLSEVLQMLSMYKMQATEVQLLVAFYSDRLQDHFSIL
PETLRGILALVQHQIISEEDAVTIVKGIFKEVQNQALLQADRNKVYAILAGLLDKHYEGIKIMDADFVFGYIQVMDGEKDPRNLLLALKIAKFIVQNFNI
DLFLDDFFEIISCYFPIDFTPPPNLPSNENVTKEDLIIVLRESLTSTRKFAGISCAKIYTATDFQEYLQPIWTAIRQEVFLSMDDQVQELSLEALKHVVV
TISSNSLQQPDQDPLNDFINMIVTETQQYLQDPELKLANPCGNVLNAVASASDRSCYSILTPIIPRLVNLYSTDKTVIFRCKVLDILIKLLNAAANCQLS
EQFIAPMDWHEIVKLLQLAMDTSEEDIRLRVTASFSILIQIKDALPADEIERISNDILKRALEDPSSIVRHGSISTLATIASVLPDVIITTVIPYIRTSV
TNLQLLLQCLANVKNRIENCLYLYHYLFDDILWLCVYNSLEESINSFEFKTIKIIASIGQLIYLNLDESSQKKFIDNLLELFMNGQVSVLKPMTVIDELP
LKQFYPLNVASSQRQVQLIEILCKILGAIKFRDGILSPNDMITNLLDISCKSVHQPSATSAAQLLSSIINKMEEGDQLENYIKSITNTICNVLYSKNVET
EMKNAVNTWIWMFAILCRYSCSLFHYSNFDIKTSFDASFQLMKALIMRSHPYSNEALIQVLKFFKLPNVGHVASAGFKIIIGDEENILCESTNAIVKFMY
KNRFFMMASEKLMENYRIASKGIKHHYLTALSHLLNGVPKQMLLNHLQMLMPLLVESVSCDEESLRLSSLQTLRPLITEAPDIISNYVASMLPELLKLCN
FPSSMKIRISALQSVNDLASLPIHLVVPYKSKVINELGNTVNDKKRLVFTVINPKKQQ*

>MMS19_sacCer Saccharomyces cerevisiae budding yeast P40469 MET18 1032 aa 13 HEAT 29%
MTPDELNSAVVTFMANLNIDDSKANETASTVTDSIVHRSIKLLEVVVALKDYFLSENEVERKKALTCLTTILAKTPKDHLSKNECSVIFQFYQSKLDDQA
LAKEVLEGFAALAPMKYVSINEIAQLLRLLLDNYQQGQHLASTRLWPFKILRKIFDRFFVNGSSTEQVKRINDLFIETFLHVANGEKDPRNLLLSFALNK
SITSSLQNVENFKEDLFDVLFCYFPITFKPPKHDPYKISNQDLKTALRSAITATPLFAEDAYSNLLDKLTASSPVVKNDTLLTLLECVRKFGGSSILENW
TLLWNALKFEIMQNSEGNENTLLNPYNKDQQSDDVGQYTNYDACLKIINLMALQLYNFDKVSFEKFFTHVLDELKPNFKYEKDLKQTCQILSAIGSGNVE
IFNKVISSTFPLFLINTSEVAKLKLLIMNFSFFVDSYIDLFGRTSKESLGTPVPNNKMAEYKDEIIMILSMALTRSSKAEVTIRTLSVIQFTKMIKMKGF
LTPEEVSLIIQYFTEEILTDNNKNIYYACLEGLKTISEIYEDLVFEISLKKLLDLLPDCFEEKIRVNDEENIHIETILKIILDFTTSRHILVKESITFLA
TKLNRVAKISKSREYCFLLISTIYSLFNNNNQNENVLNEEDALALKNAIEPKLFEIITQESAIVSDNYNLTLLSNVLFFTNLKIPQAAHQEELDRYNELF
ISEGKIRILDTPNVLAISYAKILSALNKNCQFPQKFTVLFGTVQLLKKHAPRMTETEKLGYLELLLVLSNKFVSEKDVIGLFDWKDLSVINLEVMVWLTK
GLIMQNSLESSEIAKKFIDLLSNEEIGSLVSKLFEVFVMDISSLKKFKGISWNNNVKILYKQKFFGDIFQTLVSNYKNTVDMTIKCNYLTALSLVLKHTP
SQSVGPFINDLFPLLLQALDMPDPEVRVSALETLKDTTDKHHTLITEHVSTIVPLLLSLSLPHKYNSVSVRLIALQLLEMITTVVPLNYCLSYQDDVLSA
LIPVLSDKKRIIRKQCVDTRQVYYELGQIPFE*

>MMS19_schPom Schizosaccharomyces pombe fission yeast Q9UTR1 1018 aa 14 HEAT 25%
MSSNLVALYLFSIDRSQDEANDVVDRIVEEIVTDRMGIVDLVTSIGEYLTDNNISVRAKAVLLLSQTLGELPKDRLPAKHVSVLLQFYLSRLDDEVTMKE
NALGIGALLNMQNFPAQKIVDVCKALFSSTDMPKYAQATRLNILKVFETIIDNYLFFISSQTRDAFFSGICSTFAGEKDPRNLMLVFSMLKKILSTFPID
GFEQQFFDITYCYFPITFRAPPDATNLAITSDDLKIALRETLVANDAFSKLLLPALFERLKASTVRIKIDALNIYIEACKTWRVGAYLWSAKDFWESIKQ
EILNSTDAELQNLALGALNTLASKFYKEEGFSSSFTEFVDMILIQLSQRLLEDVNVKSCGSCAAVFASLASISVETFNYCSCNFLPSVLDLPMVNEPLEK
QKGMLVFLEYVYKCLVLLYGKWRSKNQADIDNPLLVYKDKQLSFVSGSLMGTAKDETEIRMLALKVIFLMASIKNFLTESELTMVLQFLDDIAFDFSDPI
KKKATECLKDLGLLKPDFLLLTSFPFAFSKLTDDVTAKSSSEETFKQYLSVLVSISEERSLFKALVIRLVEMLKDQFKSKEMSVDLVESIVQSLSVAFKE
RNDRNEQEIPFFFEELLKQLFTLCFANCESMNVRCLIYVSQTINEIVRVNHFEFQEKFVGQLWKLYMENSNSDLIETEGCEKAAERFTLAASLSDQKFLN
LVVLLQGGLNGLSKKLHFIEKLNIELLNLLINVVFVTESPGVKISALRLISSLINKCEKDEDISSFISSKGVTSLWDKVYTGTPKESEAALDVLAWVDKA
LVSRKHSEGIPLAFKLLDTLNLQNVGDSSVKALSIIIKDDPALSKENSYVEKLLYKQRFYASVSPKILEHISTATGGEKSLYLMLLSNVIGNVPKEIVIP
DMPSILPLLLQCLSLSDISVKLSTLNVIHTSVKELTSLLTEYLDTLIPSLLAIPKDMNNPTVVRLLALKCLGSLPEFTPTTNLQLFRDKVIRGLIPCLDD
PKRVVRTEASRTRHKWYI*

>MMS19_araTha Arabidopsis thaliana plant NM_124186 1134 aa x HEAT 28% armadillo/beta-catenin-like
MMVEPNQLVQHLETFVDTNRSSSQQDDSLKAIASSLENDSLSITQLVREMEMYLTTTDNLVRARGILLLAEILDCLKAKPLNDTIVHTLVGFFSEKLADW
RAMCGALVGCLALLKRKDVAGVVTDIDVQAMAKSMIQNVQVQALALHERKLAFELLECLLQQHSEAILTMGDLLVYAMCEAIDGEKDPQCLMIVFHLVEL
LAPLFPSPSGPLASDASDLFEVIGCYFPLHFTHTKDDEANIRREDLSRGLLLAISSTPFFEPYAIPLLLEKLSSSLPVAKVDSLKCLKDCALKYGVDRMK
KHYGALWSALKDTFYSSTGTHLSFAIESLTSPGFEMNEIHRDAVSLLQRLVKQDISFLGFVVDDTRINTVFDTIYRYPQYKEMPDPSKLEVLVISQILSV
SAKASVQSCNIIFEAIFFRLMNTLGIVEKTSTGDVVQNGNSTVSTRLYHGGLHLCIELLAASKDLILGFEECSPTSGCANSGCSMVKSFSVPLIQVFTSA
VCRSNDDSVVDVYLGVKGLLTMGMFRGGSSPVSRTEFENILVTLTSIITAKSGKTVVWELALKALVCIGSFIDRYHESDKAMSYMSIVVDNLVSLACSSH
CGLPYQMILEATSEVCSTGPKYVEKMVQGLEEAFCSSLSDFYVNGNFESIDNCSQLLKCLTNKLLPRVAEIDGLEQLLVHFAISMWKQIEFCGVFSCDFN
GREFVEAAMTTMRQVVGIALVDSQNSIIQKAYSVVSSCTLPAMESIPLTFVALEGLQRDLSSRDELILSLFASVIIAASPSASIPDAKSLIHLLLVTLLK
GYIPAAQALGSMVNKLGSGSGGTNTSRDCSLEEACAIIFHADFASGKKISSNGSAKIIVGSETTMSKICLGYCGSLDLQTRAITGLAWIGKGLLMRGNER
VNEIALVLVECLKSNNCSGHALHPSAMKHAADAFSIIMSDSEVCLNRKFHAVIRPLYKQRCFSTIVPILESLIMNSQTSLSRTMLHVALAHVISNVPVTV
ILDNTKKLQPLILEGLSVLSLDSVEKETLFSLLLVLSGTLTDTKGQQSASDNAHIIIECLIKLTSYPHLMVVRETSIQCLVALLELPHRRIYPFRREVLQ
AIEKSLDDPKRKVREEAIRCRQAWASITSGSNIF*

>MMS19_dicDis Dictyostelium discoideum slime mold Q54J88 1115 aa 18 HEAT 31%
MTSNITELNKWIEGYVNPQSEESVKTNAINMVLLYMKSNKIDLQDVVQGLGDYLKSNDSILRARGTLLLSEVLCRLPDLPLNQDQVHFLAMFYCDRLQDY
ACSSEVVKGITGLITNHTPDYPDNQKLLRNIFSEVHPTSLTQAHRKMVLQVIDIMFNKCLSEIQELKNDFMVGYLQFIDNEKDPRNLIFSFKLLPKVIYN
IPEHKHFLESLFEIISCYFPISFNPKGNDPNSITKDDLSNSLLNCFSCTPLLAEHSIPFLIDKICSNLIETKIEALQTLVYCCDRYGGFAVQPFLEEIWS
TLRTLILTHKNTTVIEESKKTIFYLTRSFTKERKVLESFLSIMIKECLHHIKSSQDSKIAIYCASILYQSVSASLLSSKIILIHIFPNLFNFLSELQKQD
TVQKVNEQNSVIALFNDLLKANSIAFEMYSNENKEPNPLEPFVDQLFKLFSDLLLLNSSSSIRSNSIECLSNLYISKKVHTTEQDDDDSEQITNEFLLDL
EKRQFIIKSLVSLLNSSDNTLRHKSLDSLFTIASNEDPSVLNLYVIPTLLQMINHSSCNINTTNNKINNNNNNNNIVIKNNKCQDEHCNEDHSNKNENNN
NSNENSNGNSTSGSDDDLKHYLEAFTKLCTHQPLLESVIPQIQVLLQHNIKETYQSNEDFEKSILILQSISFILEKSTNIKSMTICSKSILFPLIKGLYK
QELISSSNDNNNNNNNNSNRFNQILTPTLKMIHSIFENISIESQKPLLEKLIKLFLNGDTLVINYQLPTTTTTIIKPFEKSSPYKYLIPIFTTIISQSKL
DLSENNELKQSLYQMSLDVNVDDSIAISCSKAYSSIINKQQQQQQQDQINFNFFNDNLLKVINDTTTPLPLKIRHLDLFTWCTKALLTNGNSINIKLGSC
LADIISNENVELSYHASKSFGILLSETDVLNEKSGSIIKILFEQKFFTLMFPILLESFKVSKNKELQTISSHYLIAISNLLKHVPKEILLAELNEILPIV
MQSLKSSDNNDQVQLLDSSLQTLTMLINETPSSFISYLDSLIPSLIKISTKSTKYNLKRSALEILTLLSKSIPFVNLFPYKTQVVTDIIPCLDDKKRIVR
REAQKCRNSWYILQK*

>MMS19_pytUlt Pythium ultimum stramenopiles ADOS01001616 957 aa 4 ARM units 31%
MFSLDAPLAPAIDAFVNPENDDNVHKTSLNTVVMQVHRKVSMEALIQALGLHLTSTDDKVRARAMQLLAEVLSRLPELPLTPNAVQLLVDFFADRLADYP
SASACLQALLALESNHAKKIASPTVTIILIQKMVKVLHVPQLGQAMRKQCFELMQLALGQKVVVDVLVTAPESSSIDHGLLFAQAFLNAMEGEKDPRNLL
LCLQIARELLAKLEVVFDRHDAVLQQYFDVVSCYFPITFTPPPNDPYGITSEELILSLRKAFAASDLLAKHVLPFLLEKLSSTVVEAKLDSLQTLVFCCE
AYSINVALLHMLSIANALYHEVVKGEKKEVIEASLRAISRFSSVIGLAKTKAAGGAAYAWNKFVVELTTRAMSDLTGHATDSLVSVSAGQVLAALGKDSV
LGFTHVLETSVPLLIQQFNESSTSTESKCEASLARLLLIVNTIDREVDQSASAQPMRPHALVLIDALVAFLSNNEALSTPTAKCSAIEALSHLVTYPPSP
IVEIAQVKALVELFINFLLFDASPEVRRECLQSLRAISTIKQKATVKNYASLVMEIALTQLMDAVQLSAQNTKVAAVLASSGRDHPEFFNDVLDSITQLS
QEASLFQATIVRLVDFCVVENQDSNKITFVANSSANGTQAHVDGILNAVAKIVELNADDKASMEFCVTSGGDNSIVFRLLKAVTTTAADAAAQNALLDDA
KLASCARIFRTPMQNVSTETQQLLANAAISAFLTTQSTGASASHPAYLQLVPLFSAVINSANRNLNLPETSRVINTLLELAQSSTAVYHTTASTQQIEQI
SSEAALSAAKSLASIVNKMSDGEEFDALIVLLLDQKLSQIIANEQKDVSVRVAALQIYVWIAKALVIRGHREHAPACLFFLCKFLTPETSDARSQIAMHV
AKSFKLLVTEFPDVLNRKCGAFITVRQHKKKYAGILGNADLTFYFVCVVPVPSANV*

>MMS19_sapPar Saprolegnia parasitica stramenopiles ADCG01000470 804 aa 1 large ARM repeat 31%
MFSLDAPLQPAIDGFVDPENGEQQHTTHLNNVVMSVHRKTPIEQVIQGLGAHLTHVQDKRRARATLLLAEVLTRLPDLRLSSDTAHLLLTFFLERLKDGP
SMAACLKALVALISLHAALLPANDAWTVCATCHAWCERAVVETLLNLPTPIASLSQSMRKQSFELLQLIVRRGALGDHEGRVLMDGFLRAMSGEKDPRNL
LFCLRFAAELLTTYANVVDADVAKGFFDATSCYFPITFRPPPNDPYGITSEDLVLALRSVFVGHDSLAKHVLPMVLDKLSRTTVVEMTKDILETLAFCCA
KYPLNRLLLHFTPVAAAVYHHVLHGDNTAVIAVAIDALKTITRAVSPPSKLPGMQALAWNKCIVYLVNQAVEDLAHQAPDSMVSTGAGHVLCAIASVGVA
GFSHVLSSALALLLEQCAAQAGSPAEAATARLVQLLGCIDAEVDHSAPPLVPYVSAIQTTLVHGLETATSSRQQKLCLQGLRCLVLRPPSPLLDDASLEV
LLQGWTSTVLSNPFPDVRDEATSTLQAIALKSPGLAQIVLTRCVPSFLQVLEQPAVLFFASWCGDMDDGLGQCSVWAVDRGHGARHPRGPHAALARPRHL
SAPPAAVPDQLDAPVCDRDDGGRGRHCPRQQGLGRVHGLRHPRHSHFIVGALPPRRRARRARPDAVDRRPSDRAGDGQHERACHAVRVPPGANNAAHVDL
AAGLDVGHFALAWPRPATATIERSTLLVRRGVDGARTRRAAAPLAAAVYARRAEQRRRREHSQGACGALQRPPRGHAAVRCVPKVDHVARCPPRRHGVAG
GRHS*

>MMS19_polPal Polysphondylium pallidum amoeba EFA86574 994 aa x HEAT 28%
MSKANIDSYININNNDQTKQTSLNILLLEINANKLSIHQLVEYLGDYLQNTDSILRARGTLLLSEVLCRLPDLKLNEAQVEFLAAFYHDRLQDYACASEV
VKGVYGLCVNHKVPYPHNQKMIRAIFQEVHPSTLVQTHRKMVLQLIEHLLEHNLTEIQELKGDFMAGFLQFIDGEKDPRNIIYTFRLIPRVILYIPEYKN
FADSLFEILSCYFPISFNPKPGDPNSITKDDLVSSLLNCFGASTYFAEHCIPFLIDKICSNVVDTKIESLKTLLFCCSKYGPVALRPHLDDIWGTLRTQI
LTQKSATVIDESKKTMFYLTRVLAADQETLQSFLSMVDKECLHHIKTSQDSKLAVSCASILFQTVSASVKSSRIVLSHILPTIIDFFKELSLHLSDDPIH
KANEQLSIIGLFNDLLKANNISFQYNNENIDKEINPLEEYKDKLYDLFIGLLSNSSALVRTLAVDCLANLYVTRHIKTSVPITFVLDQEKRQSIIKDLGV
WLLIQIFRNKSLEALMSITKLEQVEQMNLFAIPTLLQMINANQSKNVSESKHYLEAFSQLCTHQPLLQSVIPQIKTLLEHSIKKKYINNDEFENSLLVLQ
SLENTFSNSIDEQTMTICYREILLPLVKELFEQVFSLDVNSQEQKDQVLGIMKPAISMIHSNNKKEAIELFINIYLNGDLSALQINKEFKPFSSDATEQA
KLLIPIFTSVISQSKFELSTNKLLKEMLMSRALDSNVEESISNACAICYGSIINKQTDQTDLPLDHLEQLISSSSTNKTQALNLLIWIEKGLVTNGNPQS
IKVGELLAQLITSENTEISQKAAKSFYILLSDHDTFDHKSGAIVKRQKNETVSSQFLVAITNLLRNVPKEVLLGELQEVLPIVLHSLHSNQRDLLNSSLQ
TLMMLVDEASTSISSHLDSLIPTLIKISVNGESLTFRQSSLEILTRISRAIPYPKIYPFRNQVINGIVPALDDKKRLVRREATKCRNSWFILQ*

>MMS19_entHis Entamoeba histolytica amoeba XP_651925 868 aa x HEAT 25%
MSTPAQQLNEFIESPKVIKEGYEIIDQLMKNNYNVNSLVTDLGDTLPSEDERIRFRATSLLTYCLIKYPIKEESKDVFVDYLASRLVDAVCLEPILTALL
QLVTKKPSDEIINEIAMAYSCMRTQLYTKEVRILVYQFYKVFINYYQATEVIDTCVQLIELERDPECLKEVFDLIKLVSQKNEIDADSAPLLFDCASAYF
PILYPPKGDEALRIDLTNKILDAFVSAPIYAQFALPFLLDKLDADLSSIKLEALKAIYFCIQRFELKYVYAYFTHIWESIEQNISTVGVVEVNEFAFAIA
SYFCSLDDFHSKNLMESIKMFCLRMMSETDEIIINFVNGLLEELTKKSEKFFKVFVPVFIQCFHDQLQDADDRPKEQFERELFIVRLIYQRIIEGMPLLD
CVKGQVAWDLHRLATPLHPCFVSLLDIDVSLALLNLLGEQRMVPFQNAIELSENKCHDAIPILQRLYEKEEDVMISLLPANKIITNLELVSGIALHSPKL
FEQLLKLIPTLQSNEYVPVFQSILSDALPFNCLDVYVNHCIPVFIVITNGVLSPLFNTLMNRLSRLHSILSSKKISELTEGVLSQLKEHSRLLLILPSLL
QFYQPENLIVYLNEVQEVDKDTIAIYSLLISKLTNIIPHVLEQNKEYFNGYKTIQELDSHESNKQATPIFIEELCRMNNKAIECLKEMIVFDSINKKNEL
HWKEELFNLVYERFIESHQVTTVEESHIMILLFSLLPTEKLLTYESTVLKIFNIICVPTSHLNEIDSVVVLLFNILPTVSQYPMSLIESELDSIITKLFN
VLYINGTTIKYRCDIIDLLTRIRVVYGIDAIRPYQKNVIKKLLVPLDDNKRLVRRSAAICRNIWETTA*

>MMS19_naeGru Naegleria gruberi early eukaryote: heterolobosea XP_002678884 1070 aa x HEAT 27%
MQTSSNSNGEQELISLIDSLCNPTLPNTNKESLKSKLIEFVVNGTLTINEGIKLLGEYLNHATDDRIRGAAYAVLDLILENIPNNVGSETDETKQTTQLK
LVASLLRFIGDRFYDFDCLATLLPCLFSLFKKWSSYISSEQAINVVLQFFENVNIQSIGSTSGVAHATKTRSLCFEWFSLLADRFPSIVRTIDFLNGFIQ
SLEGERDPGNLLYCFNLIPKVIAIFDDSELSSKILSAVSDDLFDITSCYFPITYTPPANDTRGITREDLSRSLKLCFGCNKFFAPTLFPFLLEKLSSDLV
DTKLETLDYLCYCIEKFGEVNSREYLTEIWSYIKAESVKTNSMDVMKKCYESITKIARIVIIPNDPSNKPFDIPNIEAILRTALLELKSKEPKFAAQYAR
MIYACAVPTFEISMMVFNRVMPELVATLSESDTKDKLYGSLLMITQLLQAVAEQKGENQLPEVVFNLISQVQTVFLSIYEEEFSKNDKEMILVMVETISR
IAIFRIPSTLLRDIYVSRILLKSYGEENKSFSLLHATSLEEYKERVIKDIAWIYKYAPDIVSEDILVPLFGALYGCENKSEHINRILSNISAVGKVCPSM
TPSITHRLFERIESIPISESHYEHERVKVFETITSLDVSLIPAHDKVSYIQRIVKMSVTDSSSQMVDDSDTMDCSDSECAHVHHNQGNFSFLTLLLGRSL
ENELQQVVLDSVLQYANSVPSTGLKNFISVLSAIVIACRPTVGMGNLITMTDSLLQMALKGEQPSQVTKCIAQLVGSVLNKLPLDSTEFQQLITICNATV
FDAFSQMLTVYNGDSESAERYIEMVSWILKGLVMRGAYVPHADRYSSLLCGSLVFEYNSSKVNKKVAEGFLIAIGEDETSIHKENHAIIQVLYKQRFFAT
NVRKLMDSINTVTQPHIIGSILLALSNLIHNVPTKVILSEVKNIFPIVLKFLEMRQILIEQDNNSEDLLYAAIKTTLTLLSDAKEEMSVHLSSIVPILLD
TCKFKKSQAVRILSVEALLELTNGYKYYEIYPLKKDIIKGLEACLDDKKRKVRKAAVKCRNSYFVLSNNQ*

>MMS19_phyInf Phytophthora infestans early eukaryote: stramenopiles 1114 aa x HEAT 33%
MVSYEQLGSLPQKGSQNPVVNQKLEAIAMFSLDAPLAPAIDAFVDPENDDAAQKTGLNTVVMQVHRHVSMEALIQALGAYLTNGDDKVRSRATLLLAEVL
TRLPELQLTPSAVQLLMTFFADRLADFPSASACLRALLALETHHAAQVQSPRTTVALIPKLGKTLHIPQLGQAMRKMCFDLMQLALMQSTVVELLLDSVP
ASKDAQDASVDDAEQSEDLGRQLAQTFLSAMEGEKDPRNLLLCMQVARTLLSKLEPVFSRSDTLLQQYFDVVSCYFPIIFTPPPNDPYGITSEGLILSLR
HAFAASDLLAPLVLPFLLKKLASTVVEAKLDAIQTLVFCGERYSVNALLLQMHAVATALYDEVLDGEKQEVIAEARQAISRFSGVVARAKAQDTPGAAYA
WSKFVVDMTARAAGELRENAADSMVSVSAGQVLAALGRESSMSFAHVLKIAVPLLVEQLNNESSGSDSVPSKCEAALARILLLIDTIDREIDQSGQGQPM
RPHAAALIDALVNFLSSDHDNQTKPGSSPTARCVAVEALCHLLTFPPSPIVAPAQVKALINLFTRMLLLDPVAEVRTACLQSLKEISTVSTASEGSTNSG
EHPVTGGYAAFVVEISLARLMAAVSEGSDQEDDDDEEGTGVAAVLTASNRNFDSFFEEALLAITELCRESSIFQATIFLLIDLCVEKGDGKQSAIGFCEA
EGDATRQRHVDCILDAVAKIVEINAGDRTSMEFCVKASSSASIIFRLLTAVETLAARATASSGYKSGLVDEVKLSACVRIFRAVMQNVSSATQQQLVDAV
VPAFLRTNTSEPASLQFVPLFAAVINSAARDVALPDSSLVINRLLELAQSGATAVSESPPRQLQLVYTDAALSAAKSLASIVNKMSDGAEFDALIDLLLS
RKLAVVISNSAESFTVRVAALQIYAWIAKALVIRGHKVHAPVCLRFLCSFLTPDGDVNMEQEGDDQHAAALRMEVAKTFKLLVSEYLDVLNRKCGAFITF
LYRQRLFDLVFPVLLEYIRARIDEESSVAALVAFAQVIAHSPKAIYLPHLAQIFPLMVQALNTDDRELGSAAIQTFKPLLLESVESAKPFLKDVFPGLLK
QAQFGYVVSCSDS*

>MMS19_albLai Albugo laibachii early eukaryote: stramenopiles 1077 aa x HEAT 27%
MFQLDAPLSPAIKKFIDSGASNDEETGQKTSLNAVVMHTHRIGSIETLIQELEPYLTDDCNDFARARATLLIAEVLTRLPDLPLSGNRIQVLNNFFCARL
DDPPSIPASFQALLALQKHHSTEIPDSENMELVIRISDTLHVPQLNQPMRKRYYELVYLVIQQERMQKALSRSQQAQVFIRSFLNAMTGEKDPRNLKHCF
QIAQTMMQKLEMVFQEAELSEQYFRVISCYFPITFTPPPNDPYGVTTEELIRSLRNVLTASDVLIHQMVPFLLEKLSGSMSEEAKVDALDTLGHCVETFS
LKNLLLHIRSIGQVFYHEILNGERARVIETASNVLSRVSSVIGRAKVQGSSGSGFAWNAVVVTITNQAVEKLHENSVDSMSSASAGKVLASMSRESLVVS
THVLNTSMPLLIEQVKHSFEASSSQCEAALDRLMLFVDTIDEEVEQISTIHPIHSHASPILEALVKFLEEDTPTSTPNAKRLSIRIISHLVIYPSTPVVR
PSDVERIVRLFTRGFLSDASKHVRSEFLSSLKALSGAIKTPSTLQSVHCKREKTLQLYGTLLKEHCIAQLLALVQDGKSPEAETFQKSSCRTRKDFEQDT
LAAITELSHDPVIFKEAVVHLLQSCFIDQDGLLIFRSFEVEHTLQFFQAVATIIELNASNASNMEFCASIDDQNGIAFKLLDAFVSMAMSNGQSKEQKFL
PPNAIAFSTRILRTIMQNICFDTQQKLLDRAISRFHPILQTEESTPSQHLYQIVSAFSTVINSANRSLAFPKAYCVIDSLMAVSRSITTESHGYTNEIVL
LISQSIGSILNKVRDKHFEAKVESLLTGLSQSIHNDQEQAQWHTSIEVYIWITKGLLLCGHPKYSSQSVAFLTQLLIHHSDKGVRGQVAEGVRVILTEFP
NVLNRKCGASCNMLFRQRLFELVGPNLLAFISKHSEETTEALTGFCYIVAFSPKAAFISLISTIMPLVLRGLSSDHVELGAAAIKAYKIVSDTSIEHVKP
FLKDVFHGLLQQAQHSANALDRKDALECIGMLTTLPYELIHSYKDRVLRQLLFCLDDRKRFVRYTAVRVRNKWSVL*
>CIAO1_homSap Homo sapiens O76071 length=339 3FM0_A PDB: 3FM0
MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTT
LEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSL
AFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQ
AHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL*

>CIAO1_droMel Drosophila melanogaster Q7K1Y4
MGRLILEHTLQGHKGRIWGVAWHPKGNVFASCGEDKAIRIWSLTGNTWSTKTILSDGHKRTIREIRWSPCGQYLASASFDATTAIWSKSSGEFECNATLE
GHENEVKSVSWSRSGGLLATCSRDKSVWIWEVAGDDEFECAAVLNPHTQDVKRVVWHPTKDILASASYDNTIKMFAEEPIDNDWDCTATLTSHTSTVWGI
DFDADGERLVSCSDDTTIKIWRAYHPGNTAGVATPDQQTVWKCVCTVSGQHSRAIYDVSWCKLTGLIATACGDDGIRIFKESSDSKPDEPTFEQITAEEG
AHDQDVNSVQWNPVVAGQLISCSDDGTIKIWKVTE*

>CIAO1_triAdh Trichoplax adhaerens B3RNR8
MTTVAFLPLSFPFLIFNFGQYIRIWAKNSDSDQWTCKSILTEGHTRTIRSVAWSPCGNYLASCSFDATICIWSKKDGDFECMATLEGHENEVKCVNWSSS
GVYLASCSRDKSAWIWEFIEEDEEYECASVLTDHSQDVKHVVWSPKENALVSASYDNTIKIYKEVDDDWECSHTLIGHESTVWSLSFHSSGELFVSCGDD
KVLKIWKCLKSGPSDVKWISICTIAGYHNRPIYDVDWSKLNNKIATACGDDAIRIFSIVRITISISNQLLFIAYYQAHNHDVNVVRWHPKVDNILASGSD
DNCIKIWKVHSNN*

>CIAO1_nemVec Nematostella vectensis A7RWD2 cnidarian
MTGHEDRVWSVAWSPNGFVLASCGGDKTIRIWGKEGDKWICKTILEDGHQRTIRSLGWSPCGTFLASASFDATTCIWDQKSGEFECNATLEGHENEVKSV
DWSVSGSLLATCGRDKSVWIWEVQEDDEYECASVIHSHTQDVKKVVWHPTKEILASCSYDDTIKLYKEDEDDWSCCDTLEGHESTVWSISFDGSGDRIVS
CSDDKTVRIWKSYPPGNQEGVVVSGKHTKWKCVCVLSGYHDRTIYDVHWSKVSGLIATASGDDCIRIFKEDTNSDRNQPSFQLVATQRKAHSMDVNSICW
HPKDENILATCSDDGTVKLWRFTPAEE*

>CIAO1_sacCer Saccharomyces cerevisiae  A6ZYM0 length=330 Cia1 YDR267C PDB: 2HES
MASINLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLL
AIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTV
WSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWGFNGLIASVGADGVLAVYEEVDGEWKVFAKRALCHGVYEINV
VKWLELNGKTILATGGDDGIVNFWSLEKAA*

>CIAO1_chlRei Chlamydomonas reinhardtii A8IZG4
MDPFTLEPIGALSGHDDRVWNVAWSPQGDMLASCSGDKTVRIWSRRQPRPSEQWYCSAILDQCHTRTIRSVAWSPTGRALATASFDATVAVWELSSGVWE
QVAELEGHENEVKCVAWNPDGRLIATCGRDRSVWIWESMPGREFECVDVKQGHSQDVKAVTWHPSGELLVSAGYDDTIKLWTYDGDEWGCAQTLGGTGTG
HESTVWDVCWDPVSRARLASCSDDLTLRLWESRAAPTSTPASAPAGAAAAGFVPSRPDLRCAVTLSGHHRRTVFSLDWAPTGLIATGDGDDSILAEEEAS
GLLTQPGGQWGCWARVAKAHGADVNCVRWNPAEPRLLASCSDDGLIRLWWLR*
 
>CIAO1_dicDis Dictyostelium discoideum XP_646229 amoebozoa
MTDTTKNDKYNLKLIDSMQKEAPYDKVWNLAWHPNGEILATCANDKYIQIWSKDTNGKWGLVQSLEGHEKTVRRVAWSPCGRFLAGASFDASTSIWEKSK
DELEFTHVSSLEGHTYEVKSVAWDSTGTLLATCSRDKSIWIWQMEDDNDFECLSINSGHGQDIKCVLWHPNEELLASSSYDDTIKFWKDIDGDWECINTL
TGHESSIWDLAFNKDGDKLVSCGEDKLVLFWKFDKENEKWINIFKFKNENSRPIYSIDWSSLTNTIVTGSADDSIIFYEQESDDTPDKYKIILKKKNAHD
SDVNCTKWNPKFKNILASCGDDGFIKIWELQDK*

>CIAO1_polPal Polysphondylium pallidum EFA75350 amoebozoa
MSLNEISVLSYDQPSKIWNIEWSPDGKLLASCGDDKTIHIWMEESENKWVVLQKLEAHEKTVRRIAWSPDGKYLAAASFDASTSIWEVNNGEFNHISTLE
GHSFEVKSVAWDASGQLLATCSRDKSIWIWQMEDDQDFECISINNGHSQDVKCVRWHPSLEILASASYDDTIKMWQDTDGDWECIDTLSAHESTIWDIQF
NASGNRLVSCSDDRSVCFWRLDSTTGRWKLLSRLESVHSRPIFSVDWSHNQELSPTEQLICTGGGDDSIIIYHQKQQQQQQQSDSSSSSSTTPNEIEQYE
ILYKHEKAHKSDINSIRWNPKKPNILASSGDDSTIKIWSFVC*

>CIAO1_tetThe Tetrahymena thermophila XP_001017221 alveolata
MIEEKMEEQKEFVKCIGQLNGHTDKIWSVSWHPTLDIFATCSSDKTIKIWGLKENSENQYELKQTISDTHERTIRTLAFSPDGMMLACGSFDSTISIYAL
NNGSFEFVSKLEGHEHEVKCVAWDSEGKFLASCSRDKTVWVWDYENGFDFSCYSVIDAHTQDVKHVKWIPGTNNLASTSFDDKLKLWEQEDDDWKCSATY
SNHSATVWCVEFSKTGQYMASCGDDKQIKVYKKNENGAFSSPYIVETTIKNAHARTIYSLSFSEDATFLASVGADNTLNVYQKNMYVTTFEGQDNNLYEL
LEKKVNCHFADINCVAFHPSKDILVTVSDDRQIKLWSVEINL*

>CIAO1_phySoj Phytophthora sojae EGZ17716 stramenopiles fragment
LGVRGHPRGRAGPHHPRLRYRARCRSPDGRYLASVSFDATTVIWEKQGSSYEVISSLEGHESEVKSVAWSPSGSYLATCSRDKSVWIWEADADTDFECIS
VLHGHTQDVKFVAWHPTEDLLVSASYDDTVRIWAENDDDWYCKETLAGHTSTVWGVALNPQGTQMASVSDDTDVVVWQRDVNSKEVNEDGSPKEWKQAFT
VSGCHERTIFSVDWSKHGDLLVTGAADNAIRVFQGQPTDSPSSFELAVQQKEAHASDINCVRWSPQLQEDGGKKALLLASASDDGLVRIWKLQLP*

>CIAO1_thaPse Thalassiosira pseudonana XP_002294332 stramenopiles fragment
EWKLIATIREGHSRTIRSVAFAPTSSTLGVPILASASFDGKVLIWEHFADEENHGTFEPIAQLEGHENEIKHLAWNQTGSLLASCGRDKTIWIWECFLPG
TVGGSASGGGGDDEGEFECLAVLQGHEGDVKSIAFALSHGQWGEGDEILLSASYDNSIKVWAEESGDWYCAATLAVHTSTVWCLGINPGGVRFLSGSEDG
SMAIWKMYTATERKRLFPREHAVSSTDGLWNSGHGRIASGGGDNCIQIYREETGGSGAGSSSDAPKFAIEAMAINAHDGDVNCVKWYPRDGTSLVSCGDD
GAVRIWKYSQAG*

>CIAO1_naeGru Naegleria gruberi XP_002680935 heterolobosea
MTTNDDLAALTTQEIISAVEGNVSDHEESVWSIAWHPKYSNLLATCSSDKTVRLYYVRVLSPSGRLFAKCIDVLENQHNRTIRRVDWSLPSGNALACASF
DGTSSIWILLQNKLQNHLQALEEESQNSKESSPTTSANLGLLKCVSTLEGHENEVKSVAWNYKSASLMDQSDDHDGEDGDCGLLATCGRDKTVWVWEAID
KVGFSDFDCNSVCSGHTQDVKFVAWHPLTRSNMPSLLYSASYDNTIRIWKEGGFEEDHDRQSDEWKCVGILRGHTSTVWGLAFEPQLSSDDPEYPQYMVS
VGDDKSLILWREDVVGNYIDMNVTQVQTISDVHTRTIYYVDWCVYKHPSTGQSISLVATAGGDNTIAIYQFDTTTRQLKLLTKIANAHDSDINCCIWNKN
EFGLLSSCSDDGAVKFWKLKM*