Selenoprotein evolution: SECIS

From Genomewiki

Jump to: navigation, search

Contents

Introduction to selenocysteine insertion into selenoproteins

The SECIS element in 3' UTR of selenoproteins allows the insertion of selenocysteine for the appropriate TGA codon at time of translation. Auxillary gene products make this happen, including a selenocysteine-specific translation elongation factor (eEFSec), Sec-tRNA[Ser]Sec, ribosomal protein L30, and a binding protein SBP2.

The SBP2 protein has three domains, including a conserved L7Ae RNA binding motif for SECIS RNA binding, a partially overlapping ribosome binding site and a redox-sensitive cysteine-rich domain. SBP2 shuttles between the nucleus and the cytoplasm via nuclear localization motif SELEQNESSKKNKKKKEKSKSSYEVLPVQE and nuclear export signal motifs, the latter using the CRM1 pathway.

The kink-turn tertiary structure in the SECIS element is at the core of binding recognition. A mutation in that of SEPN or in SBP2 lead to rigid spine muscular dystrophy or abnormal thyroid hormone function, the latter through inadequate production of DIO2 needed to activate thyroid hormone T4.

SecisKiaaKink.jpg

A strong paralog of SBP2 was noticed and briefly studied in early papers. That protein, KIAA0256, also has 17 coding exons with near-identical intron locations and phases and full-length alignability, establishing KIAA0256 and BP2 as resulting from an ancestral segmental gene duplication. The percent identity overall is only 42% but reaches 72% (human to human) in the 3 exons defining the L7Ae kink-turn binding motif.

Since both genes can be recovered from chondrichthyes, lamprey and amphioxus, the duplication event preceded the emergence of chordates (and thus conflicts with 1R and 2R rounds of whole genome duplication, the latter leading to a gene family of 8). The roots of the selenoproteome and the insertion mechanism lie much deeper in pre-metazoa so it follows that the unduplicated parent gene must have assumed the key SECIS recognition roles (as did both descendent genes at least initially).

We could ask if KIAA0256 still plays a role in SECIS recognition in contemporary organisms (if not, what keeps it around?). One possibility is that some of the 30-odd selenoproteins preferentially use KIAA0256 over SBP2, correlating to the two observed structural classes of SECIS elements (which needs to be revisited in the genomics era). Another possibility is differential use during developmental timing or by various cell types. It's worth noting that KIAA0256 is considerably more conserved across its length than SBP2 (which has only a few exons conserved back to fish) suggesting the latter has a more limited role.

A literature review establishes that DIO, GPX, and SEPP1 were generally taken as proxies for all selenoprotein SECIS elements in terms of establishing a role for SBP2. Yet the timing of expansion of these and specialization of the former to thyroid during the period of gene duplication may have tainted their representativeness.

Possibly many other selenoproteins utilize KIAA0256 at least to some extent. That would account for the greater conservation of KIAA0256 and the difficulty finding SECIS elements in expected position for certain selenoproteins, ie their elements may be adapted to this diverged paralogous receptor and so have low Cove scores to the extent that tool is based on the SBP2 fold paradigm.

Ribosomal protein L30 appears also to bind the SECIS kink-turn and play a role in selenocysteine insertion despite its meagre length of 114 amino acids. Like many ribosomal proteins, L30 has remarkable sequence conservation, here still 94% at human-lamprey.

L30 has weak homology and secondary structure parallels to the pertinent region of BP2 and KIAA0256. These latter proteins might be viewed as domain composites that have accreted the kink-turn binding domain long ago from this undoubtedly ancient ribosomal protein. This opens a window on the origin of selenocysteine insertion in early eukaryotes.


SecisBpKink.jpg


L30 BP2.jpg


Positioning of SECIS elements in 3' UTR

SECIS DOI1.jpg

DIO2 SECIS.jpg

DIO3 SECIS.jpg

SEPN SECIS.jpg

SELM1 SECIS.jpg

SELM2 SECIS.jpg

SECIS GPX3.jpg

..................SECIS GPX6.jpg

GPX1 SECIS.jpg

SEPP1 SECIS.jpg

SEPHS2 SECIS.jpg

GPX2 SECIS.jpg

GPX4 SECIS.jpg

TXNRD1 SECIS.jpg

TXNRD3 SECIS.jpg

TXNRD2 SECIS.jpg

SELH SECIS.jpg

MSRB1 SECIS.jpg

SECIS SELI.jpg

SECIS SELK.jpg

SECIS SEPW1.jpg

SELO SECIS.jpg

SELS SECIS.jpg

SELT SECIS.jpg

SELV SECIS.jpg

SECIS SEPP2.jpg

Comparative genomic analysis of SECIS elements

Key residues for SECIS functioning

Below the residues considered key to SECIS element functionality have been extracted from the 358 sequences in the reference set collection. The first column gives gene name, genus, species, and COVE score rounded to the nearest integer. The second thru fourth columns give the traditional critical regions in SECIS structure as provided by SECIS tool in its output spacing. The fifth column, when all is pasted in a spreadsheet, re-sorts back into gene name in phylogenetic order.

The table is currently sorted by col4, col3, then col2 to bring together similar anomalies. Some but not by no means all of the departures from conventional wisdom are artefacts from genome assemblies and comp genomics methods. However many anomalies are consistent by gene and correlate with adjacent column anomalies, so are verly likely valid). It is clear from comparing this to the alignment conservation of SECIS elements that our picture of what is important in a SECIS element needs considerable revision -- the many billion years of comparative genomics branch length swamp out local errors even before curation.

>TXNRD1_ratNor_28  atgaa  aa  agaa  99
>TXNRD1_musMus_28  atgaa  aa  agaa  98
>DIO2_galGal_25    atgaa  aa  agat  349
>DIO2_anoCar_27    atgaa  aa  agat  348
>DIO2_ornAna_25    atgaa  aa  agat  347
>SELT_ornAna_36    atgaa  aa  agat  166
>SELT_monDom_37    atgaa  aa  agat  165
>SELT_loxAfr_36    atgaa  aa  agat  164
>SELT_eriEur_39    atgaa  aa  agat  162
>SELT_bosTau_39    atgaa  aa  agat  161
>SELT_felCat_39    atgaa  aa  agat  159
>SELT_canFam_39    atgaa  aa  agat  158
>SELT_oryCun_39    atgaa  aa  agat  157
>SELT_cavPor_39    atgaa  aa  agat  156
>SELT_ratNor_39    atgaa  aa  agat  155
>SELT_musMus_39    atgaa  aa  agat  154
>SELT_otoGar_39    atgaa  aa  agat  153
>SELT_macMul_39    atgaa  aa  agat  152
>SELT_panTro_39    atgaa  aa  agat  151
>SELT_homSap_39    atgaa  aa  agat  150
>SELM1_macMul_28   atgaa  aa  cagat  64
>SELM1_panTro_28   atgaa  aa  cagat  63
>SELM1_homSap_27   atgaa  aa  cagat  62
>SEPP1b_danRer_24  atgaa  aa  ccgag  36
>SELM1_tupBel_25   atgaa  aa  ccgat  66
>TXNRD1_monDom_23  atgaa  aa  cgaa  107
>GPX1_cavPor_15    atgaa  aa  cgat  281
>GPX3_galGal_31    atgaa  aa  cgat  261
>SELT_equCab_38    atgaa  aa  cgat  160
>SEPN_dasNov_27    atgaa  aa  cgat  48
>TXNRD1_echTel_20  atgaa  aa  cgat  106
>SELV_sorAra_26    atgaa  aa  ctgac  183
>SELM1_loxAfr_27   atgaa  aa  ctgat  77
>SELM1_dasNov_24   atgaa  aa  ctgat  76
>SELM1_bosTau_24   atgaa  aa  ctgat  75
>SELM1_equCab_29   atgaa  aa  ctgat  74
>SELM1_felCat_30   atgaa  aa  ctgat  73
>SELM1_canFam_28   atgaa  aa  ctgat  72
>SELM1_eriEur_27   atgaa  aa  ctgat  71
>SELM1_sorAra_26   atgaa  aa  ctgat  70
>SELM1_otoGar_28   atgaa  aa  ctgat  65
>SELI_anoCar_22    atgaa  aa  ggaa  224
>TXNRD1_galGal_27  atgaa  aa  ggaa  110
>TXNRD1_anoCar_33  atgaa  aa  ggaa  109
>TXNRD1_ornAna_19  atgaa  aa  ggaa  108
>TXNRD1_loxAfr_23  atgaa  aa  ggaa  105
>TXNRD1_equCab_22  atgaa  aa  ggaa  104
>TXNRD1_felCat_24  atgaa  aa  ggaa  103
>TXNRD1_eriEur_26  atgaa  aa  ggaa  101
>TXNRD1_tupBel_25  atgaa  aa  ggaa  97
>TXNRD1_otoGar_23  atgaa  aa  ggaa  96
>TXNRD1_panTro_25  atgaa  aa  ggaa  95
>TXNRD1_homSap_25  atgaa  aa  ggaa  94
>SELI_galGal_25    atgaa  aa  ggag  225
>SELI_ornAna_19    atgaa  aa  ggag  223
>SELI_monDom_26    atgaa  aa  ggag  222
>TXNRD1_canFam_25  atgaa  aa  ggag  102
>SELI_loxAfr_26    atgaa  aa  ggat  221
>SELI_dasNov_18    atgaa  aa  ggat  220
>SELI_equCab_20    atgaa  aa  ggat  219
>SELI_canFam_14    atgaa  aa  ggat  218
>SELI_eriEur_14    atgaa  aa  ggat  217
>SELI_oryCun_19    atgaa  aa  ggat  216
>SELI_cavPor_17    atgaa  aa  ggat  215
>SELI_ratNor_25    atgaa  aa  ggat  214
>SELI_musMus_25    atgaa  aa  ggat  213
>SELI_otoGar_21    atgaa  aa  ggat  212
>SELI_macMul_21    atgaa  aa  ggat  211
>SELI_panTro_22    atgaa  aa  ggat  210
>SELI_homSap_22    atgaa  aa  ggat  209
>SELT_tetNig_33    atgaa  aa  ggat  170
>SELT_danRer_35    atgaa  aa  ggat  169
>SELT_galGal_38    atgaa  aa  ggat  168
>SELT_anoCar_34    atgaa  aa  ggat  167
>SELT_sorAra_36    atgaa  aa  ggat  163
>MSRB1_galGal_22   atgaa  aa  ggat  93
>SEPP1a_monDom_31  atgaa  aa  ggat  17
>SEPP1a_canFam_33  atgaa  aa  ggat  11
>SEPP1a_sorAra_33  atgaa  aa  ggat  9
>SEPP1a_cavPor_35  atgaa  aa  ggat  7
>SEPP1a_tupBel_31  atgaa  aa  ggat  4
>SELK_galGal_31    atgaa  aa  tgaa  245
>GPX4_musMus_36    atgaa  aa  tgag  314
>GPX3_bosTau_31    atgaa  aa  tgag  255
>GPX3_ratNor_33    atgaa  aa  tgag  251
>GPX3_musMus_33    atgaa  aa  tgag  250
>TXNRD2_echTel_37  atgaa  aa  tgag  129
>DIO3_bosTau_23    atgaa  aa  tgat  358
>GPX1_bosTau_30    atgaa  aa  tgat  287
>SELS_echTel_38    atgaa  aa  tgat  145
>SEPP1a_danRer_33  atgaa  aa  tgat  20
>SEPP1a_anoCar_33  atgaa  aa  tgat  19
>SELO_monDom_24    atgaa  cc  cgac  174
>GPX3_felCat_30    atgaa  ga  tgag  253
>GPX3_canFam_30    atgaa  ga  tgag  252
>SEPHS2_otoGar_12  atgac  aa  agaa  54
>GPX4_sorAra_37    atgac  aa  agac  318
>SEPHS2_bosTau_22  atgac  aa  agac  60
>GPX6_panTro_23    atgac  aa  agag  263
>SEPHS2_equCab_22  atgac  aa  agag  59
>SEPHS2_felCat_22  atgac  aa  agag  58
>SEPHS2_canFam_20  atgac  aa  agag  57
>SEPHS2_ratNor_19  atgac  aa  agag  56
>SEPHS2_macMul_21  atgac  aa  agag  53
>SEPHS2_panTro_21  atgac  aa  agag  52
>SEPHS2_homSap_21  atgac  aa  agag  51
>DIO3_cavPor_24    atgac  aa  ccgaa  355
>DIO3_loxAfr_22    atgac  aa  cgaa  359
>GPX4_galGal_39    atgac  aa  cgaa  323
>GPX4_anoCar_39    atgac  aa  cgaa  322
>GPX4_macMul_33    atgac  aa  cgaa  312
>GPX3_ornAna_31    atgac  aa  cgaa  259
>SELS_anoCar_25    atgac  aa  cgaa  148
>SEPP2_tetNig_17   atgac  aa  cgac  208
>GPX4_canFam_31    atgac  aa  cgag  317
>GPX4_ratNor_34    atgac  aa  cgag  315
>GPX2_ornAna_28    atgac  aa  cgag  309
>TXNRD2_equCab_31  atgac  aa  cgag  128
>TXNRD2_canFam_34  atgac  aa  cgag  127
>TXNRD2_panTro_31  atgac  aa  cgag  121
>TXNRD2_homSap_31  atgac  aa  cgag  120
>SEPW_ratNor_27    atgac  aa  cgat  329
>GPX4_monDom_41    atgac  aa  cgat  320
>GPX4_echTel_41    atgac  aa  cgat  319
>GPX1_eriEur_19    atgac  aa  cgat  283
>SELS_sorAra_36    atgac  aa  cgat  143
>MSRB1_ornAna_26   atgac  aa  cgat  92
>SELV_echTel_26    atgac  aa  ctgag  185
>SELV_equCab_33    atgac  aa  ctgat  182
>SELV_otoGar_27    atgac  aa  ctgat  178
>DIO3_felCat_29    atgac  aa  tgaa  357
>DIO3_ratNor_26    atgac  aa  tgaa  354
>DIO3_musMus_26    atgac  aa  tgaa  353
>DIO3_macMul_30    atgac  aa  tgaa  352
>DIO3_panTro_31    atgac  aa  tgaa  351
>DIO3_homSap_31    atgac  aa  tgaa  350
>GPX1_dasNov_29    atgac  aa  tgaa  288
>SELH_loxAfr_26    atgac  aa  tgaa  200
>SELH_bosTau_28    atgac  aa  tgaa  197
>SELH_equCab_26    atgac  aa  tgaa  196
>SELH_felCat_25    atgac  aa  tgaa  195
>SELH_canFam_24    atgac  aa  tgaa  194
>SELH_otoGar_23    atgac  aa  tgaa  189
>TXNRD2_ratNor_35  atgac  aa  tgaa  124
>TXNRD2_tupBel_37  atgac  aa  tgaa  122
>SEPP2a_ornAna_34  atgac  aa  tgac  206
>DIO3_canFam_26    atgac  aa  tgag  356
>GPX2_cavPor_20    atgac  aa  tgag  299
>SEPP1b_ornAna_18  atgac  aa  tgag  34
>DIO1_sorAra_24    atgac  aa  tgat  337
>DIO1_bosTau_28    atgac  aa  tgat  336
>DIO1_cavPor_24    atgac  aa  tgat  335
>GPX1_ratNor_26    atgac  aa  tgat  280
>GPX1_tupBel_21    atgac  aa  tgat  278
>SEPN_loxAfr_32    atgac  aa  tgat  49
>SEPP2_monDom_30   atgac  aa  tgat  204
>MSRB1_oryCun_28   atgac  aa  tgat  87
>GPX4_cavPor_34    atgac  ca  agac  316
>GPX4_panTro_29    atgac  ca  cgaa  311
>GPX4_homSap_29    atgac  ca  cgaa  310
>GPX4_ornAna_34    atgac  ca  tgaa  321
>SELO_takRub_20    atgac  ca  tgaa  175
>GPX6_echTel_31    atgac  ga  cgaa  273
>GPX3_echTel_13    atgag  aa  ccgag  257
>SELM1_cavPor_31   atgag  aa  ctgat  69
>SELM1_ratNor_30   atgag  aa  ctgat  68
>SELM1_musMus_35   atgag  aa  ctgat  67
>SEPP2b_ornAna_23  atgag  aa  ggaa  207
>TXNRD1_cavPor_24  atgag  aa  ggat  100
>SEPP1a_ornAna_29  atgag  aa  ggat  18
>SEPP1a_echTel_33  atgag  aa  ggat  16
>SEPP1a_loxAfr_33  atgag  aa  ggat  15
>SEPP1a_dasNov_33  atgag  aa  ggat  14
>SEPP1a_bosTau_31  atgag  aa  ggat  13
>SEPP1a_equCab_29  atgag  aa  ggat  12
>SEPP1a_eriEur_33  atgag  aa  ggat  10
>SEPP1a_ratNor_33  atgag  aa  ggat  6
>SEPP1a_musMus_33  atgag  aa  ggat  5
>SEPP1a_macMul_31  atgag  aa  ggat  3
>SEPP1a_panTro_31  atgag  aa  ggat  2
>SEPP1a_homSap_31  atgag  aa  ggat  1
>SELK_loxAfr_35    atgag  aa  tgac  241
>SELK_dasNov_29    atgag  aa  tgac  240
>SELK_bosTau_39    atgag  aa  tgac  239
>SELK_felCat_37    atgag  aa  tgac  238
>SELK_canFam_36    atgag  aa  tgac  237
>SELK_otoGar_32    atgag  aa  tgac  229
>SELK_macMul_36    atgag  aa  tgac  228
>SELK_panTro_35    atgag  aa  tgac  227
>SELK_homSap_35    atgag  aa  tgac  226
>GPX3_anoCar_28    atgag  aa  tgag  260
>GPX3_tupBel_29    atgag  aa  tgag  249
>GPX3_macMul_28    atgag  aa  tgag  248
>GPX3_panTro_28    atgag  aa  tgag  247
>GPX3_homSap_28    atgag  aa  tgag  246
>DIO1_ornAna_24    atgag  aa  tgat  339
>SEPW_dasNov_29    atgag  aa  tgat  331
>GPX1_loxAfr_25    atgag  aa  tgat  289
>GPX1_oryCun_24    atgag  aa  tgat  282
>GPX1_macMul_26    atgag  aa  tgat  276
>GPX1_panTro_20    atgag  aa  tgat  275
>GPX1_homSap_20    atgag  aa  tgat  274
>SELK_eriEur_37    atgag  aa  tgat  236
>SELK_sorAra_41    atgag  aa  tgat  235
>SELK_cavPor_34    atgag  aa  tgat  233
>SELK_ratNor_33    atgag  aa  tgat  232
>SELK_musMus_32    atgag  aa  tgat  231
>SELK_tupBel_37    atgag  aa  tgat  230
>GPX6_loxAfr_19    atgat  aa  agaa  272
>GPX6_dasNov_20    atgat  aa  agaa  271
>GPX6_cavPor_20    atgat  aa  agaa  265
>GPX6_sorAra_23    atgat  aa  agag  270
>GPX6_bosTau_23    atgat  aa  agag  268
>GPX6_macMul_22    atgat  aa  agag  264
>GPX6_homSap_18    atgat  aa  agag  262
>GPX3_monDom_23    atgat  aa  agag  258
>GPX3_loxAfr_16    atgat  aa  agag  256
>GPX3_equCab_26    atgat  aa  agag  254
>GPX6_equCab_25    atgat  aa  cagaa  267
>SEPW_musMus_34    atgat  aa  ctgat  328
>SELV_loxAfr_34    atgat  aa  ctgat  184
>SELV_cavPor_34    atgat  aa  ctgat  181
>SELV_ratNor_33    atgat  aa  ctgat  180
>SELV_musMus_33    atgat  aa  ctgat  179
>SELV_panTro_34    atgat  aa  ctgat  177
>SELV_homSap_34    atgat  aa  ctgat  176
>SELM1_anoCar_32   atgat  aa  ctgat  79
>SELM1_ornAna_27   atgat  aa  ctgat  78
>SEPHS2_dasNov_18  atgat  aa  ggag  61
>DIO2_monDom_29    atgat  aa  ggat  346
>DIO2_dasNov_27    atgat  aa  ggat  345
>DIO2_canFam_27    atgat  aa  ggat  344
>DIO2_ratNor_28    atgat  aa  ggat  343
>DIO2_musMus_29    atgat  aa  ggat  342
>DIO2_macMul_30    atgat  aa  ggat  341
>DIO2_homSap_30    atgat  aa  ggat  340
>MSRB1_macMul_22   atgat  aa  ggat  82
>MSRB1_panTro_23   atgat  aa  ggat  81
>MSRB1_homSap_26   atgat  aa  ggat  80
>SEPP1a_oryCun_33  atgat  aa  ggat  8
>GPX2_equCab_28    atgat  aa  tgaa  304
>SELK_anoCar_34    atgat  aa  tgaa  244
>SELH_anoCar_27    atgat  aa  tgaa  203
>SELH_monDom_27    atgat  aa  tgaa  202
>SELH_echTel_27    atgat  aa  tgaa  201
>SELH_dasNov_26    atgat  aa  tgaa  199
>SELH_sorAra_24    atgat  aa  tgaa  198
>SELH_ratNor_24    atgat  aa  tgaa  192
>SELH_musMus_25    atgat  aa  tgaa  191
>SELH_tupBel_27    atgat  aa  tgaa  190
>SELH_macMul_27    atgat  aa  tgaa  188
>SELH_panTro_24    atgat  aa  tgaa  187
>SELH_homSap_24    atgat  aa  tgaa  186
>TXNRD2_cavPor_34  atgat  aa  tgaa  125
>TXNRD2_musMus_37  atgat  aa  tgaa  123
>SEPHS2_musMus_22  atgat  aa  tgaa  55
>SEPP1b_anoCar_16  atgat  aa  tgaa  35
>SEPP1b_monDom_16  atgat  aa  tgaa  33
>SEPP1b_echTel_18  atgat  aa  tgaa  32
>SEPP1b_loxAfr_14  atgat  aa  tgaa  31
>SEPP1b_dasNov_14  atgat  aa  tgaa  30
>SEPP1b_bosTau_13  atgat  aa  tgaa  29
>SEPP1b_equCab_16  atgat  aa  tgaa  28
>SEPP1b_canFam_16  atgat  aa  tgaa  27
>SEPP1b_sorAra_15  atgat  aa  tgaa  26
>SEPP1b_oryCun_16  atgat  aa  tgaa  25
>SEPP1b_tupBel_16  atgat  aa  tgaa  24
>SEPP1b_macMul_20  atgat  aa  tgac  23
>SEPP1b_panTro_20  atgat  aa  tgac  22
>SEPP1b_homSap_20  atgat  aa  tgac  21
>GPX2_echTel_30    atgat  aa  tgag  307
>GPX2_loxAfr_27    atgat  aa  tgag  306
>GPX2_bosTau_26    atgat  aa  tgag  305
>GPX2_felCat_22    atgat  aa  tgag  303
>GPX2_canFam_23    atgat  aa  tgag  302
>GPX2_eriEur_25    atgat  aa  tgag  301
>GPX2_sorAra_29    atgat  aa  tgag  300
>GPX2_ratNor_31    atgat  aa  tgag  298
>GPX2_musMus_34    atgat  aa  tgag  297
>GPX2_tupBel_29    atgat  aa  tgag  296
>GPX2_otoGar_28    atgat  aa  tgag  295
>GPX2_macMul_30    atgat  aa  tgag  294
>GPX2_panTro_30    atgat  aa  tgag  293
>GPX2_homSap_30    atgat  aa  tgag  292
>SELK_oryCun_39    atgat  aa  tgag  234
>MSRB1_equCab_24   atgat  aa  tgag  90
>TXNRD2_eriEur_35  atgat  aa  tgag  126
>DIO1_eriEur_26    atgat  aa  tgat  338
>DIO1_macMul_29    atgat  aa  tgat  334
>DIO1_ponPyg_29    atgat  aa  tgat  333
>DIO1_homSap_29    atgat  aa  tgat  332
>SEPW_macMul_34    atgat  aa  tgat  327
>SEPW_ponPyg_31    atgat  aa  tgat  326
>SEPW_panTro_36    atgat  aa  tgat  325
>SEPW_homSap_36    atgat  aa  tgat  324
>GPX2_monDom_26    atgat  aa  tgat  308
>GPX1_ornAna_26    atgat  aa  tgat  291
>GPX1_monDom_26    atgat  aa  tgat  290
>GPX1_equCab_27    atgat  aa  tgat  286
>GPX1_felCat_28    atgat  aa  tgat  285
>GPX1_canFam_22    atgat  aa  tgat  284
>GPX1_musMus_30    atgat  aa  tgat  279
>GPX1_otoGar_25    atgat  aa  tgat  277
>SELK_ornAna_34    atgat  aa  tgat  243
>SELK_monDom_22    atgat  aa  tgat  242
>SELS_galGal_36    atgat  aa  tgat  149
>SELS_ornAna_33    atgat  aa  tgat  147
>SELS_monDom_41    atgat  aa  tgat  146
>SELS_dasNov_36    atgat  aa  tgat  144
>SELS_eriEur_37    atgat  aa  tgat  142
>SELS_bosTau_41    atgat  aa  tgat  141
>SELS_equCab_41    atgat  aa  tgat  140
>SELS_felCat_41    atgat  aa  tgat  139
>SELS_canFam_39    atgat  aa  tgat  138
>SELS_cavPor_40    atgat  aa  tgat  137
>SELS_ratNor_40    atgat  aa  tgat  136
>SELS_musMus_42    atgat  aa  tgat  135
>SELS_tupBel_40    atgat  aa  tgat  134
>SELS_otoGar_38    atgat  aa  tgat  133
>SELS_macMul_37    atgat  aa  tgat  132
>SELS_panTro_37    atgat  aa  tgat  131
>SELS_homSap_37    atgat  aa  tgat  130
>SEPN_monDom_27    atgat  aa  tgat  50
>SEPN_bosTau_32    atgat  aa  tgat  47
>SEPN_equCab_38    atgat  aa  tgat  46
>SEPN_felCat_29    atgat  aa  tgat  45
>SEPN_canFam_35    atgat  aa  tgat  44
>SEPN_sorAra_34    atgat  aa  tgat  43
>SEPN_cavPor_35    atgat  aa  tgat  42
>SEPN_ratNor_35    atgat  aa  tgat  41
>SEPN_musMus_35    atgat  aa  tgat  40
>SEPN_macMul_32    atgat  aa  tgat  39
>SEPN_panTro_32    atgat  aa  tgat  38
>SEPN_homSap_32    atgat  aa  tgat  37
>SEPP2_macEug_26   atgat  aa  tgat  205
>MSRB1_bosTau_28   atgat  aa  tgat  91
>MSRB1_felCat_32   atgat  aa  tgat  89
>MSRB1_canFam_29   atgat  aa  tgat  88
>MSRB1_cavPor_26   atgat  aa  tgat  86
>MSRB1_ratNor_22   atgat  aa  tgat  85
>MSRB1_musMus_24   atgat  aa  tgat  84
>MSRB1_otoGar_25   atgat  aa  tgat  83
>GPX6_eriEur_24    atgat  ca  agag  269
>GPX6_canFam_24    atgat  ca  agag  266
>SELO_macMul_26    atgat  cc  tgag  173
>SELO_panTro_26    atgat  cc  tgag  172
>SELO_homSap_26    atgat  cc  tgag  171
>SEPW_canFam_34    atgat  ga  ctgat  330
>SELH_cavPor_19    gtgat  ca  tgaa  193
>GPX4_tupBel_31    ttgac  aa  cgag  313
>TXNRD3_bosTau_13  ttgac  ag  cgac  119
>TXNRD3_calJac_25  ttgac  ga  tgat  114
>TXNRD3_ratNor_25  ttgac  gg  cgac  116
>TXNRD3_musMus_22  ttgac  gg  cgac  115
>TXNRD3_macMul_18  ttgac  gg  cgac  113
>TXNRD3_felCat_20  ttgac  gg  cgat  118
>TXNRD3_canFam_27  ttgac  gg  cgat  117
>TXNRD3_homSap_19  ttgac  gg  tgac  111

Gene-by-gene colored alignment of SECIS elements

Here the SECIS elements are colored red when identical at 90% of the input sequences and blue when 80%. These alignments would be more easily compared if the sequencs were trimmed to a common length and sporadic small insertions removed. It may be possible, especially within a given gene family, to find conserved regions in common that extend beyond the regions traditionally considered important to SECIS recognition.

Secis1.jpg

Secis2.jpg

Secis3.jpg

Secis4.jpg

Secis5.jpg


Gene-by-gene text alignment of SECIS elements

Here all SECIS sequences (except SELM) are aligned using the 3 key regions identified by SECIS web tool (output spacing) as alignment anchors. To trim the sequences to a common length, 20 flanking residues were taken on the 5' and 3' sides (rather than the full-length element reported by the SECIS tool). Dots are used as spacers to bring sequence divisions to common lengths. Numbers appended to the gene name provide COVE scores.

                                        *****                **                                  ****                     * = key regions
>SEPP1a_homSap_31  ccagtgttctatttgcttta atgag aatagaaacgt .. aa actatgacctaggggtttctgtt ........ ggat aattagcagtttagaatgg
>SEPP1a_panTro_31  ccagtgttctatttgcttta atgag aatagaaacgt .. aa actatgacctaggggtttctgtt ........ ggat agttagcagtttagaatgg
>SEPP1a_macMul_31  ccagtgttctatttgcttta atgag aatagaaacgt .. aa actatgacctaggggtttctgtt ........ ggat agttagcaatttagaatgg
>SEPP1a_tupBel_31  ccagtattctatttgcatta atgaa gacagaaacat .. aa actatgacctaggggtttcggtt ........ ggat aggtagcaatttagaatgg
>SEPP1a_musMus_33  ccagtgttctagttacatta atgag aacagaaacat .. aa actatgacctaggggtttctgtt ........ ggat agcttgtaattaagaacgg
>SEPP1a_ratNor_33  ccagtgttctagttacattg atgag aacagaaacat .. aa actatgacctaggggtttctgtt ........ ggat agctcgtaattaagaacgg
>SEPP1a_cavPor_35  ccagaattctatttgcattg atgaa aacagaaacat .. aa actatgacctaggggtttctgtt ........ ggat acatagtaatttagaatgg
>SEPP1a_oryCun_33  ccagcattctacttgcatta atgat aacagaaacgt .. aa actatgacctaggggtttctgtt ........ ggat aattagtaatttagaatgg
>SEPP1a_sorAra_33  ccaatattctatttgcatta atgaa gacagaagcaa .. aa actatgacctaggggcttctgtt ........ ggat acttagcaattgggatgga
>SEPP1a_eriEur_33  ccagcattctacttgcagta atgag gacagaaacgt .. aa actatgacctaggggtttctgtt ........ ggat agttagcaatttagaatgg
>SEPP1a_canFam_33  ccagcattctacttgcatta atgaa aacagagacat .. aa actatgacctaggggtttctgtt ........ ggat agttagcaatttagaatgg
>SEPP1a_equCab_29  ccagcattctacttgcatta atgag aacagaaacgt .. aa actatgacctaggggtttctgtg ........ ggat agttagcaatttagaatgg
>SEPP1a_bosTau_31  ccagtattctacttgcgtta atgag aacagaaacgt .. aa actataacctaggggtttctgtt ........ ggat ggttggcaactaagaatgg
>SEPP1a_dasNov_33  ccagcattctatttgcatta atgag aacagaaacat .. aa actatgacctaggggtttctgtt ........ ggat agttagcaatttagaatgg
>SEPP1a_loxAfr_33  ccagcattctctttgcatta atgag aacagaaacat .. aa actatgacctaggggtttctgtt ........ ggat agttagcaatttagaatgg
>SEPP1a_echTel_33  ccagcattctttttgcatta atgag aacagaaacgt .. aa actatgacctaggggtttctgtt ........ ggat actctgcaatttagaatgg
>SEPP1a_monDom_31  cctgtgttctgcttgcatta atgaa gacagaagcat .. aa actataacttaggggcttctgtt ........ ggat aatttgcaatccagaatgg
>SEPP1a_ornAna_29  ctgccgttctgcttgcattt atgag aacagaaacat .. aa actataaacctaggggtttctgtt ....... ggat agttagcaatcaagaatgg
>SEPP1a_anoCar_33  ctaccattctgtttgcattc atgaa aacagaagccg .. aa actatgacctaggggcttttgtt ........ tgat atattgcagccaagaacag
>SEPP1a_danRer_33  aagtgctttatgtggtcttt atgaa ggcaggtgcag .. aa actatgcactagtggtgtctgtc ........ tgat gtttggccatacagagcag
>SEPP1b_homSap_20  agtaagtatttccatagtca atgat ggtttaataggt . aa accaaaccctataaacc .............. tgac ctcctttatggttaatact
>SEPP1b_panTro_20  agtaagtatttccatagtca atgat ggtttaataggt . aa accaaaccctataaacc .............. tgac ctcctttatggttaatact
>SEPP1b_macMul_20  agtaagtatttccatagtca atgat ggtttaataggt . aa accaaaccctataaacc .............. tgac ctcctttacggttaatact
>SEPP1b_tupBel_16  agaaagtatttccatagtca atgat ggttcaataggc . aa actaatccctataaacc .............. tgaa ctcctttatggttaatact
>SEPP1b_oryCun_16  ctcagagtatctccatatta atgat ggtttaacaggt . aa actaaaccctatgaacc .............. tgaa tttctttatggataatact
>SEPP1b_sorAra_15  agaaagtatttccatagtca atgat ggtttaataggt . aa acttatttcctgtaaaccc ............ tgaa cttctttatggttaatacc
>SEPP1b_canFam_16  agaaagtatttccatagtca atgat ggttcaataggt . aa actaagtcctataaacc .............. tgaa ctcctatatggttaatact
>SEPP1b_equCab_16  agaaagtatttccatagtca atgat ggttcaataggt . aa actaagtcctataaacc .............. tgaa ctcctttatggttaatact
>SEPP1b_bosTau_13  agaaagtatttccatagtca atgat ggttcaataggc . aa accaggtcctataaacc .............. tgaa ttttttttatggtcaatac
>SEPP1b_dasNov_14  agaaagtatttccataatca atgat ggttcagtaggt . aa actaagccctataaacc .............. tgaa ctcctttatggttaatacc
>SEPP1b_loxAfr_14  tagaagtatttccatcatca atgat ggttcaataggt . aa accaaatcctataaacc .............. tgaa ctccttatggttaatactg
>SEPP1b_echTel_18  agaaagtatttccatagtta atgat gattcattaggt . aa atttagtcttgtgaatc .............. tgaa ctcatttatggttaatact
>SEPP1b_monDom_16  agaaagtgttcccatagtta atgat ggtttaacaggt . aa attgactcctgtggacc .............. tgaa ctcttttatggttcatact
>SEPP1b_ornAna_18  gaaagtatttgccatagtta atgac ggttcagtaggg . aa atccaatcctatgaacc .............. tgag ctcttctatggttaatgct
>SEPP1b_anoCar_16  gattgtgcttgccatagttc atgat ggtttattaggg . aa ataaattctacaaaacc .............. tgaa ttcctttatggtgaacaca
>SEPP1b_danRer_24  ttaaacattttttatactta atgaa ggttttctggt .. aa atcttgtatcacctggaagac .......... ccgag aaactgtatggaaatgtat
>SEPN_homSap_32 .. gcttccccggcagcagcccc atgat ggctgaatccg .. aa atcctcgatgggtccagct ............ tgat gtctttgcagctgcaccta
>SEPN_panTro_32 .. gcttccctggcagcagcccc atgat ggctgaatccg .. aa atcctcgatgggtccagct ............ tgat gtctttgcagctgcaccta
>SEPN_macMul_32 .. gcttccccagcagcagcccc atgat ggctgaatccg .. aa atcctcgatgggtccagct ............ tgat gtctttgcagctgcaccta
>SEPN_musMus_35 .. gctcccccagcaacagccgc atgat ggctgggtctg .. aa atcgcaaatggatccagcc ............ tgat gtcctcgcagttgcacatg
>SEPN_ratNor_35 .. tttcccccagcagcagccgc atgat ggctgggtctg .. aa atcccaaaaggatccagcc ............ tgat gtcctcgcagttgcacatg
>SEPN_cavPor_35 .. gatccccgagcagcagcccc atgat ggctggatccg .. aa atcctagatggatctagct ............ tgat gcctttgcagttgcactta
>SEPN_sorAra_34 .. tccccacccgcaaccgcctc atgat ggctggatctg .. aa atcctagatggatctggct ............ tgat gtctttgcgattgtcctgt
>SEPN_canFam_35 .. tctcccgcagcagcagcccc atgat ggctggatctg .. aa atcctagatgggtccagct ............ tgat gtctttgcagctgcaccta
>SEPN_felCat_29 .. tctcccccagcagcagcccc atgat ggctggatctg .. aa atcctagacgggcccagct ............ tgat gtctttgcagctgcacctg
>SEPN_equCab_38 .. tggctcctcgcggctgcccc atgat ggctggatctg .. aa atcctggatgggtccagct ............ tgat gtctccgcagttgcaccta
>SEPN_bosTau_32 .. tgccccctagcagccgcccc atgat ggctggatctg .. aa agcttaggtggatccagct ............ tgat gtctttgcagttgctcctg
>SEPN_dasNov_27 .. gctcctccagcagccgccgc atgaa ggatggatctg .. aa atcccagatggatccagcc ............ cgat ctctttgcagttgcacctg
>SEPN_loxAfr_32 .. gttccccaagcaactgcccc atgac agctgggtctg .. aa atcctagatggacccagtt ............ tgat gtctttgcagtagcacctc
>SEPN_monDom_27 .. ttctcctgcaactgttcttt atgat ggctagatcct .. aa atcctagatgggtcaagtt ............ tgat gtcttgacagtaactgaag
>SEPHS2_homSap_21  atctgacttggtctctgtta atgac gtctctccctct . aa accccattaaggactgggagaggc ....... agag caagcctcagagcccaggc
>SEPHS2_panTro_21  atctgacttggtctctgtta atgac gtctctccctct . aa accccattaaggactgggagaggc ....... agag caagcctcagagcccaggc
>SEPHS2_macMul_21  atctgacttggtctctgtta atgac gtctctccctct . aa actccattaaggactgggagaggc ....... agag caagcctcagagcccaggc
>SEPHS2_otoGar_12  atctgacttcatctctgctg atgac atttctcccttg . aa aggctactaagggcaggg ............. agaa gcagaggaagtcccagcgc
>SEPHS2_musMus_22  acctgacttggtctctgata atgat gtctctccctct . aa ctcccagtaaggactgggagaggc ....... tgaa caaacctcagagccaggtg
>SEPHS2_ratNor_19  atctaacttggtctctgtta atgac gcctctctctgt . aa accccactacggactgggggaggc ....... agag caaacccagagcccaggct
>SEPHS2_canFam_20  atctgatttggtctctgtta atgac gtttctccctct . aa accccttttaggactgggagaggc ....... agag taagccccagagcccaaac
>SEPHS2_felCat_22  atctgatttggtctctgtta atgac gtctctccctct . aa acccctttaaggactgggggaggc ....... agag caagccccagagcccaagc
>SEPHS2_equCab_22  atctgacttggtctctgtta atgac gtctctccctct . aa accccgttatggactgggagaggc ....... agag caagccccagagcccaggc
>SEPHS2_bosTau_22  accttacttggtctctgtta atgac gtctctctcta .. aa cccctttaaggactgggagaggc ........ agac caaaccccagagaccagga
>SEPHS2_dasNov_18  acctggcctggtctctgtta atgat gtttctccctct . aa accccgttaaggactgggagaggc ....... ggag tgagccccagagcccaggc
>SELM1_homSap_27 . attcacaaagatttgcgtta atgaa gactacacaga .. aa acctttctagggatttgtgtggat ....... cagat acatacttggcaaattttt
>SELM1_panTro_28 . attcacaaagatttgcgtta atgaa gactacacaga .. aa acctttctaaggatttgtgtggat ....... cagat acatacttggcaaattttt
>SELM1_macMul_28 . attcacaaagatttgcgtta atgaa gactacacaga .. aa accttcctaaggatttgtgtggat ....... cagat acatacttggcaaattttt
>SELM1_otoGar_28 . attcacaaaaatttgcatta atgaa gactacacaga .. aa acctttcagaggatttgtgtggat ....... ctgat acttggcaaattttgagtt
>SELM1_tupBel_25 . attcacaaagatttgcgtta atgaa gactgcacaga .. aa acctttctagggatttgtgtggat ....... ccgat aattggcaaatttttgtat
>SELM1_musMus_35 . acttataaaggtttgcatta atgag gattacacaga .. aa acctttgttaaggacttgtgtagat ...... ctgat aattggcaaatttttattt
>SELM1_ratNor_30 . acttataaaggtttgcatta atgag gattacacaga .. aa acctttgttaagggtttgtgtcgat ...... ctgat aattggcaaatttttattt
>SELM1_cavPor_31 . ggccacaaaaacttgcatta atgag gactatacaga .. aa accttcctaaggatttgtatagat ....... ctgat gtatggcaaatttttgttt
>SELM1_sorAra_26 . ttgcacaaagattcgcatta atgaa ggctacacagg .. aa accttactaaggatttgtgtggat ....... ctgat aactagcaaatttttgtgc
>SELM1_eriEur_27 . actcacaaaggtttgcatcc atgaa ggctacataga .. aa accttactgaggatttgtgtagat ....... ctgat gctcagcaaacttctgtgt
>SELM1_canFam_28 . cttcacagagatttgcatta atgaa gactacacaga .. aa accttcaggaggatttgtgtggat ....... ctgat atttagcaaaattttgtgt
>SELM1_felCat_30 . attcacaacgatttgcatta atgaa gactacacaga .. aa accttcatgaggatttgtgtggat ....... ctgat gatatttagcaaatttttg
>SELM1_equCab_29 . attcacaaagattcgcgtta atgaa gactacacaga .. aa acctttctgaggatttgtgtggat ....... ctgat atccggcaaatttttgtgc
>SELM1_bosTau_24 . tcacacaaagatttgcatta atgaa gactacacaga .. aa accttcctgaggatttgtgtggac ....... ctgat acttagcaaatttttgtgc
>SELM1_dasNov_24 . atttacaaagatttgcacta atgaa gactacacaga .. aa acctttctaaggatttgtatggat ....... ctgat atttggcaaatttttgtgt
>SELM1_loxAfr_27 . attcacaaagatttgcatta atgaa gactgcacaga .. aa acctttgtaaggatttgtgtggat ....... ctgat atttggcaagtttttgtgt
>SELM1_ornAna_27 . catgaagacaatgcgcatta atgat gactacacaga .. aa acctatcatggatttgtgtatat ........ ctgat gtttcgtgtatttcctcag
>SELM1_anoCar_32 . tgccagcaaaatactcttta atgat gactacatgta .. aa gcctttaacaaaaggcatgtgtaggt ..... ctgat gtcagatgtacttttgtta
>MSRB1_homSap_26 . gccctggccctggtcactgc atgat ccgctctggtc .. aa acccttccaggccagccagagtgg ....... ggat ggtctgtgacctgctggga
>MSRB1_panTro_23 . gccctggccctggtcactgc atgat ccgctctggtc .. aa acccttccaggccagccagggtgg ....... ggat ggtctgtgacctgctggga
>MSRB1_macMul_22 . gccctggccctggtcactgc atgat ctgctctggtc .. aa acccttccaggccagccagcgtgg ....... ggat ggtctgtgacctgctggga
>MSRB1_otoGar_25 . gctccagcccaagtcaatgc atgat ctcctctggct .. aa atccttccaggccagccagggtgg ....... tgat gtctgtgacctgctggggg
>MSRB1_musMus_24 . gctccagcctcagtcaccga atgat ctgctctggtc .. aa atccttctatgccagccagggtgg ....... tgat gacccgtgacctttgagga
>MSRB1_ratNor_22 . actccagcctcagtcactgt atgat ctgctctggtt .. aa atccttctgtgccagcccagggtgg ...... tgat gacctgtgaccttcgagga
>MSRB1_cavPor_26 . gcttcagccctggtcaatgc atgat ctactctggct .. aa atccttctaggccagtcagggtgg ....... tgat gatctgtgacctgctgggg
>MSRB1_oryCun_28 . gcccccgccccggtcactgc atgac ccgctctggct .. aa acccttccagggcagccagggtgg ....... tgat ggtctgtgacctgcggcgg
>MSRB1_canFam_29 . gctgcagctgcagtcactac atgat tcactctggtt .. aa acccttccaggcagccagagtgg ........ tgat gatctgtgacctgctagag
>MSRB1_felCat_32 . gctccggccctggtcactac atgat tcactctggtc .. aa agccttccaggcagccagagtgg ........ tgat gatctgtgacggctggagg
>MSRB1_equCab_24 . tgctccagcccagtcactgc atgat tcactctggtg .. aa acccttcggggcggccagagtgg ........ tgag gacctgtgacccgctggag
>MSRB1_bosTau_28 . tgccccagcccagtcactct atgat tctctctggct .. aa acccttgcaggcagccagagtgg ........ tgat gacccgtgacccgctgggg
>MSRB1_ornAna_26 . cccacctggttttcagcatt atgac tcgccctgggg .. aa agccctcctggagcgccagggcga ....... cgat ggtcacctgatcgggtggg
>MSRB1_galGal_22 . ttctgggctgggatcatggt atgaa ttgtcctctgt .. aa atcctcctgggatgcgagggtgg ........ ggat gttttgtgatcctgctgga
>TXNRD1_homSap_25  ggcatcgaagggatgcatcc atgaa gtcaccagtctc . aa gcccatgtggtaggcggtgat .......... ggaa caactgtcaaatcagtttt
>TXNRD1_panTro_25  ggcatcgaagggatgcatcc atgaa gtcaccagtctc . aa gcccatgtggtaggcggtgat .......... ggaa caactgtcaaatcagtttt
>TXNRD1_otoGar_23  tgcatcgacgggatgcgtcc atgaa gtcaccagcctc . aa gcctgtgtggtgggcagtgat .......... ggaa caactgtccaatcagtttc
>TXNRD1_tupBel_25  cgcatcagagggatgcgtcc atgaa gtcaccagcctc . aa gcccgtgcggtgggcggtgat .......... ggaa cgactgccagatcagtttc
>TXNRD1_musMus_28  agcatcacaggcatgcgtcc atgaa gtcactggcctc . aa gcccaagtggtgggcagtgac .......... agaa gagctgccgggtctgttga
>TXNRD1_ratNor_28  cagagcatcacggtgcgtcc atgaa gtcactagcctc . aa gcccaagtggtgggcagtgac .......... agaa agctgtcgatctgttgggt
>TXNRD1_cavPor_24  cggcaccgtagggtgcgtcc atgag gtcaccagcctc . aa gcccgagggtgggcggtgac ........... ggat cgcgccgcgtggctcagct
>TXNRD1_eriEur_26  agcatcaaagggatgcgtcc atgaa gtcaccagcctc . aa gcccgtgcgggtgggcagtgac ......... ggaa cactgtcgaagcagtttca
>TXNRD1_canFam_25  tgcatcggcgtggtgcgtcc atgaa gtcactggcctc . aa gccatgcggtgggcagtgat ........... ggag caactgtcgagcagtttta
>TXNRD1_felCat_24  gcgcatcggagggcgcgtcc atgaa gtcaccggcccc . aa gcccccgcggtgggcggtgat .......... ggaa caagtgccgagcagtttta
>TXNRD1_equCab_22  tgcatcgaagggatgcgtcc atgaa gtcactggcctc . aa agcccatgtggtgggcggtgat ......... ggaa cagctgtcgaagcagtttt
>TXNRD1_loxAfr_23  gcgcatcgagggatgcatcc atgaa gtcactggcctc . aa gcccatgtggggggcggtgat .......... ggaa cagctgtcgaatcagcttt
>TXNRD1_echTel_20  gtgcatcaagagatgcgttc atgaa atcgcttgcccc . aa gcccgagtggcgggcag .............. cgat ggaacatctgtctcatcag
>TXNRD1_monDom_23  tgcatcggtgagatgcgttc atgaa gtcgctgcctg .. aa gcccatatcccgtggtgggtggtgac ..... cgaa agaaccgccggcctccgtt
>TXNRD1_ornAna_19  tgcacccaagggctgcattt atgaa gtcagagccaa .. aa gccagcattttgcggttggctgtgat ..... ggaa aaactcctgccacagtttt
>TXNRD1_anoCar_33  gcattgttcaagatgcttcc atgaa gtcacagtcta .. aa accagtgctttctggtaggcagtgat ..... ggaa agattgctggcacaacttg
>TXNRD1_galGal_27  ggcatttcacacatgctttc atgaa atcacagcctg .. aa gcctgcactgtctggtgggcagtgat ..... ggaa gaactgctgacacagctga
>TXNRD3_homSap_19  gaagcagtgggactgcttcc ttgac gccttagctt ... gg agccccgttatgaggtgagccaaggc ..... tgac tctcgcaagccaggactga
>TXNRD3_macMul_18  gaagcagtgggactgcttcc ttgac gccttagctt ... gg agccctgttgtgaggtgagccaaggc ..... cgac tctcgcaagccaggactca
>TXNRD3_calJac_25  gaagcagtgggactgcttcc ttgac gccttagctc ... ga agccctgttacgaggtgagccaaggc ..... tgat tctcgcaagcgaggactga
>TXNRD3_musMus_22  gcagcagccaggctgcttcc ttgac accttggctc ... gg aacctgcagaggtgagccaaggc ........ cgac ttctgcacgtcagcctcga
>TXNRD3_ratNor_25  gcagcagccaggctgcatcc ttgac gccttggctc ... gg aacctgcagaggtgagccaaggc ........ cgac tcctgcacgtcagcctcga
>TXNRD3_canFam_27  gaggcaggcaggctgcctcc ttgac gccttagctc ... gg aaccgctgtgaggtgagctaaggc ....... cgat gtcctccatgccaggccag
>TXNRD3_felCat_20  gaggcaggtcggctgcctcc ttgac gtcttagctc ... gg agcccgatgtgaggtgagctaaggc ...... cgat ggtcttccacgtcagaatc
>TXNRD3_bosTau_13  agggcagactcgctgcctcc ttgac gtcttcgctc ... ag agccgccaggtgagccaagac .......... cgac ctctgcccaccagctcctc
>TXNRD2_homSap_31  caggctcctggtgccagatg atgac gacctgggtgg .. aa acctaccctgtgggcacccatgtc ....... cgag ccccctggcatttctgcaa
>TXNRD2_panTro_31  caggctcctggtgccagatg atgac gacctgggtgg .. aa acctaccctgtgggcacccatgtc ....... cgag ccccctggcatttctgcat
>TXNRD2_tupBel_37  caggcccccgatgccagatg atgac ggcctggacag .. aa acccaccctgtgggctgcccaggtc ...... tgaa ccctccctggtgtctttgg
>TXNRD2_musMus_37  gacactcccagcgtcagatg atgat ggcctgggcag .. aa accccatgtgggccgcccaggtt ........ tgaa cccctggcatttctagagc
>TXNRD2_ratNor_35  cacactgccagtgtcagatg atgac ggcctgtgcag .. aa acccccacgtgggctgcccaggtt ....... tgaa cccctggcatttctggagt
>TXNRD2_cavPor_34  caggtccccagtgccagttg atgat ggcctgggcag .. aa acccaccctgtgggcagtccatgtc ...... tgaa ctccctggcatttctggag
>TXNRD2_eriEur_35  caggcccccgatgccagata atgat gacttgtgcag .. aa acccacccgggctgcccatgtc ......... tgag cctctgtggcattctggag
>TXNRD2_canFam_34  ccaggccccgatgccagaag atgac gacgtgtgcag .. aa acccccctgtgggctgcccgcgtc ....... cgag ccccctggcgtttctggaa
>TXNRD2_equCab_31  caggttcccgatgccagacg atgac gacctgcgcgg .. aa acccaccctgtgggctgcccacgtc ...... cgag ccccctggcatttctgaag
>TXNRD2_echTel_37  ccccacctcagcgccagatg atgaa gacatgtgcag .. aa acccagcccgtgggctgcccatgtc ...... tgag ccccctgacgtttctggag
>SELS_homSap_37 .. tctgtgacaggttgcgttga atgat gtcttccttatc . aa tggtgagcccaccagtgaggattac ...... tgat gtggacagttgatggggtt
>SELS_panTro_37 .. tctgtgacaggttgcgttga atgat gtcttccttatc . aa tggtgagcccaccagtgaggattac ...... tgat gtggacagttgatggggtt
>SELS_macMul_37 .. tctgtgacaggttgcgttga atgat gtcttccttatc . aa tggtgagcccaccagtgaggattac ...... tgat gtggacagttgatggggtt
>SELS_otoGar_38 .. tctgtgacaggttgcgttga atgat gtcttccttat .. aa atggtgagcccaccagtgaggattac ..... tgat acagacagttgatggggtt
>SELS_tupBel_40 .. tctgtgacagggtgcgtcga atgat gtcttccttat .. aa atggtgagcccaccactgaggagtac ..... tgat gcagacagttgacagggtt
>SELS_musMus_42 .. tctgtgacgggatgcgttga atgat gtcttccttat .. aa atggtgaacccaccagtgaggattac ..... tgat gttcacagttgacggggtt
>SELS_ratNor_40 .. tctgtgacaggatgcgttga atgat gtcttccttat .. aa atggtgagcccaccagtgaggattac ..... tgat gtacacagttgatggggtt
>SELS_cavPor_40 .. tctgtgacgagctgcgttga atgat gtcttccttat .. aa atggtgagcccaccagtgaggattac ..... tgat gcagacagttgatggggtt
>SELS_canFam_39 .. tctgtgacaggttgcgttga atgat gtcttccttgt .. aa acggtgagcccaccagcgaggattac ..... tgat gcagacagttgatggggtt
>SELS_felCat_41 .. tctgtgacaggttgcgttga atgat gtcttccttgt .. aa atggtgagcccaccagcgaggattac ..... tgat gcagacagttgatggggtt
>SELS_equCab_41 .. tctgtgacaggttgcgttga atgat gtcttccttgt .. aa atggtgagcccaccagcgaggattac ..... tgat gcagacagttgatgggttg
>SELS_bosTau_41 .. tctgtgacagcttgcgttga atgat gtcttccttgt .. aa atggtgagcccaccagcaaggattac ..... tgat gcagacagttgatggggtt
>SELS_eriEur_37 .. tctgtgatgggttgcgttgg atgat gtcttccttgtc . aa tggtgaacccaccagcgaggatcac ...... tgat gcagacagttgatggggtt
>SELS_sorAra_36 .. gtctctgtgataggcgacga atgac gtcgtcctcgg .. aa atggtgtgccaccagcgaggaccac ...... cgat gaagacactcctgggcgcc
>SELS_dasNov_36 .. tctgtgacaggttgcgttga atgat gtcttccttat .. aa aatggtgaacccaccagtgaggattac .... tgat aatagacagttgatggggt
>SELS_echTel_38 .. tctgtgacaggttgcgttga atgaa gtcttccttat .. aa atggtgaactcaccagtgaggattac ..... tgat aaagacagttgatgaggtt
>SELS_monDom_41 .. tctgtgacaggctgcgcaga atgat gtcttccttat .. aa atggtgagctcaccagtgaggattac ..... tgat gatagatagttgttggtgt
>SELS_ornAna_33 .. tctgtgacaggcggcattga atgat gtcttccttgt .. aa atggtgaaacccaccagtgaggattac .... tgat atagacaggagatggtatt
>SELS_anoCar_25 .. cctgtaacaagcagcaacaa atgac gtggtccttat .. aa atggtggacacatcactgaggacctc ..... cgaa gataagacagctgattggg
>SELS_galGal_36 .. tctgtgacaagctgctctgt atgat gttttccttat .. aa atggtaaacaaaccaatgaggattac ..... tgat gctagacagcagatggggg
>SELT_homSap_39 .. agagcagcgtgactgacatt atgaa ggcctgtactg .. aa gacagcaagctgttagtacagacc ....... agat gctttcttggcaggctcgt
>SELT_panTro_39 .. agagcagcgtgactgacatt atgaa ggcctgtactg .. aa gacagcaagctgttagtacagacc ....... agat gctttcttggcaggctcgt
>SELT_macMul_39 .. agagcagcgtgactgacatt atgaa ggcctgtactg .. aa gacagcaagctgttagtacagacc ....... agat gctttcttggcaggctcgt
>SELT_otoGar_39 .. agagcagcgtgactgacagt atgaa ggcctgtactg .. aa gacagcaagctgttagtacagacc ....... agat gctttcttggcaggctcgt
>SELT_musMus_39 .. agagcagcgtgactgacatt atgaa ggcctgtactg .. aa gacagcaagctgttagtacagacc ....... agat gtttcttggcaggctcgtt
>SELT_ratNor_39 .. agagcagcgtgactgacatt atgaa ggcctgtactg .. aa gacagcaagctgttagtacagacc ....... agat gtttcttggcaggctcgtt
>SELT_cavPor_39 .. agagcagcgtgactgacatt atgaa ggcctgtactg .. aa gacagcaagctgttagtacagacc ....... agat gcttttttggcaggatcgt
>SELT_oryCun_39 .. agagcagcgtgactgacatt atgaa ggcctgtactg .. aa gacagcaagctgttagtacagacc ....... agat gcttttttggcaggctcgt
>SELT_canFam_39 .. agagcagcgtgactgacatt atgaa ggcctgtactg .. aa gacagcaagctgttagtacagacc ....... agat gctttcttggcaggctcgt
>SELT_felCat_39 .. agagcagcgtgactgacatt atgaa ggcctgtactg .. aa gacagcaagctgttagtacagacc ....... agat gctttcttggcaggctcgt
>SELT_equCab_38 .. agagcagcgtggctgacagt atgaa ggcctgtactg .. aa gacagcaagctgttagtacagacc ....... cgat gctttcttggcaggctcgt
>SELT_bosTau_39 .. agagcagcgtgactgacatt atgaa ggcctgtactg .. aa gacagcaagctgttagtacagacc ....... agat gctttcttggcaggctcgt
>SELT_eriEur_39 .. agagcagcgtgactgacatt atgaa ggcctgtactg .. aa gacagcaagctgttagtacagacc ....... agat gctttcttggcaggctcgt
>SELT_sorAra_36 .. agagcagcgcggctgccctc atgaa ggcctgcactg .. aa gacagcagctgttggtgcaggct ........ ggat cttcctggcaggctcgttg
>SELT_loxAfr_36 .. agagcagcgtgactgacatt atgaa ggcctgtactg .. aa gacagcgagctgttagtacagacc ....... agat gcttttttggcaggcgcgt
>SELT_monDom_37 .. gagcagcgtggttggcacca atgaa ggcctgtactg .. aa gacagcaagctgttagtacagacc ....... agat acttactttgcagcctcgt
>SELT_ornAna_36 .. agggcaacgtgattgaaact atgaa ggcctgtactg .. aa ggcagcaaactgttagtacagacc ....... agat gttcctttgcagtctcgtt
>SELT_anoCar_34 .. aaggcaacatgaacgaaata atgaa ggtctgtactg .. aa gacagcatgctgttggtgcagact ....... ggat acttctcctcgccttcatg
>SELT_galGal_38 .. aggccgcgtgtctcggacca atgaa ggcctgtactg .. aa gacagcttgctgttggtacagact ....... ggat gcttctcttgcagtcacgt
>SELT_danRer_35 .. ggactgtggactgtggcata atgaa ggcctgcgctgc . aa acagcacactgttggcacaggct ........ ggat gctcagccaccacacacac
>SELT_tetNig_33 .. tccctgtgggctgtgaggtt atgaa ggtctgtgctg .. aa ggcaggacgactgctagctcagact ...... ggat gtccccatcactgttcacc
>SELO_homSap_26 .. ccatgcacacccgtctttcc atgat ggcagagacat .. cc agtcaggacctgacccgtctctgtc ...... tgag gccggctcagcagtgcagc
>SELO_panTro_26 .. ccatgcacacccgtctttcc atgat ggcagagacat .. cc agtcaggacctgacccgtctctgtc ...... tgag gccggctcagcagtgcagc
>SELO_macMul_26 .. ccatgcacacctgtctttcc atgat ggcagagacat .. cc agtcaggacctgacccgtctctgtc ...... tgag gccagctcagcagtgcagc
>SELO_monDom_24 .. tccccgatggctgcttctcc atgaa ggcagagatgt .. cc agtcggctccgacccgtctctgtc ....... cgac gctgactcggcagcccgag
>SELO_takRub_20 .. ccgagttctacctgcgaata atgac gactcagacaa .. ca agtctgccagtgacctgtctgactc ...... tgaa ctgtgtggtgtcgcctcag
>SELV_homSap_34 .. atcttaggagtctcagctgg atgat gagaagggctg .. aa atgttgccaagtcaggtcctttt ........ ctgat ggtggctggggctggggtg
>SELV_panTro_34 .. atcttaggagtctcagcggg atgat gagaagggctg .. aa atgttgccaagtcaggtcctttt ........ ctgat ggtggctggggctggggtg
>SELV_otoGar_27 .. atctcaggagcctcggtagg atgac gagaagggctg .. aa atattgccatgtcaggtcctttt ........ ctgat ggtggctgggactggggta
>SELV_musMus_33 .. atctcaggagcctcagcagg atgat gagaagggctg .. aa atgctgccaaaccaggtcctttt ........ ctgat ggtggctggggcttgggtg
>SELV_ratNor_33 .. gtctcaggaacctcagcggg atgat gagaagggctg .. aa atgctgccaaaccaggtcctttt ........ ctgat ggtggctggggcttggtta
>SELV_cavPor_34 .. atgttaggagctgcagcagg atgat gagaagggctg .. aa atgttgttgagtcaggtcctttt ........ ctgat ggtggctgggctgagtgga
>SELV_equCab_33 .. atctcaggagcctcggtgag atgac gagaagggctg .. aa atgttgccaagtcaggtcctttt ........ ctgat ggcggctggggctgaggtg
>SELV_sorAra_26 .. catctcaggaacctcagaag atgaa gggaagggctg .. aa atgttggcaggtcctttt ............. ctgac agtggctgtggctatgatg
>SELV_loxAfr_34 .. atctcaggagcctcagcaag atgat gagaagggctg .. aa atgttgccaagtcaggtcctttt ........ ctgat ggtggctggggctggggtg
>SELV_echTel_26 .. accccaggagccgcagcaag atgac gagaagggctg .. aa atgtcgtcaggccctttt ............. ctgag ggtggctggggctaggctc
>SELH_homSap_24 .. ctggtgatgttggaacatta atgat ggaacatggcc .. aa acttcagtcatgatcc ............... tgaa gccatggtttcttccctgc
>SELH_panTro_24 .. ctggtgatgttggaacatta atgat ggaacatggcc .. aa acttcagtcatgatcc ............... tgaa gccatggtttcttccctgc
>SELH_macMul_27 .. ctggtgatgctggaacatta atgat ggaacatggcc .. aa acttcagtcatgtgcc ............... tgaa gccatggtttctaccccgc
>SELH_otoGar_23 .. ctggtgatgttggagcatgt atgac gggacatggcc .. aa acttaagtcatgtgcc ............... tgaa gctacagtttcttcccctc
>SELH_tupBel_27 .. gtgatgttgaagggacattt atgat gggacatggcc .. aa acttcagtcatgtgcc ............... tgaa gccaaggtttcttcccctc
>SELH_musMus_25 .. ctggagatgttgaagcattt atgat ggtgcatggcc .. aa acttaagctatgcacc ............... tgaa gccatagtttcttcctcac
>SELH_ratNor_24 .. ctggagatgttgaagcattt atgat ggtgcatggcc .. aa acttaagctatgtacc ............... tgaa gccatagtttcttcctcac
>SELH_cavPor_19 .. ctggtcctgttggggcgtct gtgat gggacatggc ... ca aactaaagccatggccc .............. tgaa gccatggtctctagcatcc
>SELH_canFam_24 .. ctggtgatgttggagcattt atgac ggaacatggcc .. aa acttcagtcatgtacc ............... tgaa gccatggtttcttccctcc
>SELH_felCat_25 .. tggtgacgtttggagcattt atgac gggacatggcc .. aa atttcagtcatgtgcc ............... tgaa gccctggtttcttcccctc
>SELH_equCab_26 .. ctggtgttgttggagcattt atgac ggtacatggcc .. aa acatcagtcatgtgcc ............... tgaa gctgtggtttcttcccctc
>SELH_bosTau_28 .. ctggtgatgttggagcattt atgac gggacatggcc .. aa acttcagtcatgtccc ............... tgaa gctgtggtttcctcccctc
>SELH_sorAra_24 .. ctggtgatgttggagcattg atgat ggaacatgacc .. aa acgtcagtcatgtgcc ............... tgaa gccaagtttctttctctcc
>SELH_dasNov_26 .. ttggtgatgttggagcattt atgat gggacatggcc .. aa acttcagtcatgtacc ............... tgaa gccagtttctccccctcca
>SELH_loxAfr_26 .. ctggtgatgttggagcattt atgac ggaacatggcc .. aa acctcagtcatgtgcc ............... tgaa gccacggtttcttcccctc
>SELH_echTel_27 .. ctggtgatgttggagcattt atgat ggaacatggcc .. aa acttcagtcatgtgcc ............... tgaa gcccgtctcctcacttcca
>SELH_monDom_27 .. ccagtgagtttggagcatcc atgat ggaacctgacc .. aa atctcccagtcacgtccc ............. tgaa gcttgggctccttctcctg
>SELH_anoCar_27 .. ctctgtgagttggagcattc atgat gggatatgatc .. aa gtggagcaaatccagtcacatctc ....... tgaa gctgttgccctcctccaca
>SEPP2_monDom_30 . gcccctccctccctccaaga atgac gcccacagtga .. aa cccagagaactggtccctgtgggc ....... tgat gccccagaggggaggagag
>SEPP2_macEug_26 . gcccttccctccctcaatta atgat gcccacagtga .. aa cccggggaaccggccatggtgggc ....... tgat gccatggagaagaggaatg
>SEPP2a_ornAna_34  cccgctcccgcctcgcactc atgac gtccacggtgtc . aa ccggcccgccgggcaccgtggac ........ tgac gccggtcgaggcggagggg
>SEPP2b_ornAna_23  ggaatcaggaacccagtaac atgag gtcatcttcgg .. aa gcctgtgcctagaggaccaagataat ..... ggaa aaagtgacggacaagggtg
>SEPP2_tetNig_17 . ggctgctggtggtcccgttg atgac gtctgcgctggt . aa acctgcctgcaggagcctgtggac ....... cgac gtgtgtggacccaccggca
>SELI_homSap_22 .. tgaatgaagtttgtgcttga atgaa gagtgtatctta . aa ccccctttttttggacaggctgcactt .... ggat aaaataggcaccactgtgt
>SELI_panTro_22 .. tgaatgaagtttgtgcttga atgaa gagtgtatctta . aa ccccctttttttggacaggctgcactt .... ggat aaaataggcaccactgtgt
>SELI_macMul_21 .. tgaatgaagtttgtgcttga atgaa gagtgtatctta . aa cctcctttttttggacaggctgcactt .... ggat aacataggcaccactgtgt
>SELI_otoGar_21 .. taagtgaagtttgtgcttga atgaa gagtgtatctt .. aa acccttttttttggacaggttgcactt .... ggat aaaataggcaccattgtgt
>SELI_musMus_25 .. tgaatgaagtttgtgcttaa atgaa gagtgtgtctt .. aa acccttttttttggacaggttgcactt .... ggat aaaataggcaccactgtgt
>SELI_ratNor_25 .. tgaatgaagtttgtgcttaa atgaa gagtgtgtctt .. aa acccttttttttggacaggttgcactt .... ggat aacataggcaccgctgtgt
>SELI_cavPor_17 .. tgaatgaagtttgtgcttga atgaa gagtgtatctta . aa cccttttttttttggacaggttgcactt ... ggat aaaataggcaccactgtgt
>SELI_oryCun_19 .. tgaatgaagtttgtgcttga atgaa gagtgtatctta . aa ccctttttttttggacaggttgcactt .... ggat aaaataggcaccactgttg
>SELI_eriEur_14 .. ggaatgaagtatgtgcttga atgaa gagtgtatctt .. aa acccttttttttttttggacaggttgcactt  ggat ataataggcaccactctgt
>SELI_canFam_14 .. tgaatgaagtttgtgctcga atgaa gagtgtatctta . aa cccttttttttttggatggattgcactt ... ggat aaaataggcaccactgtgt
>SELI_equCab_20 .. tgagtgaagtttgtgctcga atgaa gagtgtattctt . aa acccttgtttttggatggattgcactt .... ggat aaaataagcaccactgtgt
>SELI_dasNov_18 .. tgaattaagtttgtgcttga atgaa gagtgtatctt .. aa accctttgtttttttggacaggttgcactt . ggat aaaataggcaccactatgt
>SELI_loxAfr_26 .. tgaatgaagtttgtgcttga atgaa gagtgtatctt .. aa acccttttttttggacaggttgcactt .... ggat aaagtaggcaccactgtgt
>SELI_monDom_26 .. tgaatgcaatttgtgcttga atgaa gagtgtgtctt .. aa atcctttatatggacaggctgcactt ..... ggag agaataagcacaaccatgt
>SELI_ornAna_19 .. tgaatgaagcttgtgcttga atgaa gagtgcatctta . aa cccattttttttggaaaagctgcactt .... ggag agaaagggcacgactgtgt
>SELI_anoCar_22 .. tgtgtgtcctttgtgcgtgt atgaa gagtgcggcctc . aa cccaggcgtcttggaagggccgcaccc .... ggaa gaaacggagcacagcaaag
>SELI_galGal_25 .. ttgagtttatttgtgcttaa atgaa gagtgcgcttc .. aa acccagaccaggagagggcgcactt ...... ggag tgagcgagtcaaaccttgc
>SELK_homSap_35 .. ctctgtgtcctcacagatga atgag gtcatgctggg .. aa ttccctctgcagggaactggcctgac ..... tgac atgcagttccataaatgca
>SELK_panTro_35 .. ctctgtgtcctcacagatga atgag gtcatgctggg .. aa ttccctctgcagggaactggcctgac ..... tgac atgcagttccataaatgca
>SELK_macMul_36 .. ctctgtgtcctcacagatga atgag gtcatgctagg .. aa ttccctctacagggaactggcctgac ..... tgac atgcagttccataaatgca
>SELK_otoGar_32 .. ctctgtgtcttcacagatga atgag gtcaggctggg .. aa ttctctcttcagggaactggcctgac ..... tgac atgcagttctataaacgca
>SELK_tupBel_37 .. ctctgtgtccccacagatga atgag gttatgccggg .. aa ttccctccacagggatctggcctgac ..... tgat acgcagttctataaatgca
>SELK_musMus_32 .. ctctgtgtccccacagatga atgag gtcatgctggg .. aa ttccctctgcaggatctagcctgac ...... tgat acgcagttctataaatgta
>SELK_ratNor_33 .. ctctgtgtcctcacagaaga atgag gtcatgctggg .. aa ctccctctgcaggatctggcctgac ...... tgat gtgcagttctataaatgta
>SELK_cavPor_34 .. ctctgtgttctcacagataa atgag gtcacgccagg .. aa ttctctcagcagggatctggcttgac ..... tgat acgcagttctctaaatgca
>SELK_oryCun_39 .. ctctgtgtccccacagatga atgat gtcaggctggg .. aa ttccctccacagggatctggcctgat ..... tgag atgcagttctataaatgcg
>SELK_sorAra_41 .. ttctgtgtccacacagatga atgag gtcatgctggg .. aa ttccctctacggggatctggcatgac ..... tgat atgcagttcgataaatgca
>SELK_eriEur_37 .. ctctgtgttctcacaggtga atgag gttatgctggg .. aa ttccctccatggggatctggcatgac ..... tgat atgcagttctataaatgca
>SELK_canFam_36 .. ctctgtgccttcacagacgg atgag gttgtgctagg .. aa ttccctccccagggatctggcatgac ..... tgac atgcagttctataaatgca
>SELK_felCat_37 .. ctctgtgtcctcacagacag atgag gtcgtgctggg .. aa ttccctccccagggatctggcatgac ..... tgac atgcagttctataaatgca
>SELK_bosTau_39 .. ctctgtgtcctcacagacga atgag gtcatgctggg .. aa ttccctccgcagggatctggcatgac ..... tgac atgcagttctataaatgca
>SELK_dasNov_29 .. ctctgtgtcctcacagatga atgag gtcatgtttggg . aa ttccctctgcagggatctggcatgac ..... tgac ttgcagttccataaatgca
>SELK_loxAfr_35 .. ctctgtgtccccacagacgg atgag gctgtgctggg .. aa ttccctctgcagggatctggcatggc ..... tgac atgcagttccataaatgca
>SELK_monDom_22 .. tgctctgtctacacagatta atgat gttgtgctggg .. aa ctcccatcttacaggatccagtgtaac .... tgat tgcaattgtataaatgcac
>SELK_ornAna_34 .. tgctgtgaacaagcagatta atgat gttttgctggg .. aa ttccttcagggatccagtataac ........ tgat aaagcaattatataaaggc
>SELK_anoCar_34 .. ctctgccaattggcgggacc atgat gttgtcctggg .. aa ttccttattctgggatccagggcaac ..... tgaa aagcagttctgttaaatta
>SELK_galGal_31 .. tctgcaatataagcagatga atgaa gttgtactggg .. aa ctccttcaaggatccagtgtaac ........ tgaa gtgcagtgttattaaatac
>GPX3_homSap_28 .. atggcaggggtggcgtcttc atgag ggaggggccca .. aa gcccttgtgggcggacctcccc ......... tgag cctgtctgaggggccagcc
>GPX3_panTro_28 .. atgtcgggggtggtgtcttc atgag ggaggggccca .. aa gcccttgtgggcggacctcccc ......... tgag cctgtctgaggggccagcc
>GPX3_macMul_28 .. atgtcaggggtggcgtcttc atgag ggaggggccca .. aa gcccttgtgggcggacctcccc ......... tgag cctgtctgaggggccagct
>GPX3_tupBel_29 .. gtgtcaggggtggcatctcc atgag ggaggggcccg .. aa gcccttgtgggcggacctcccc ......... tgag cctgtctgaggggccggcc
>GPX3_musMus_33 .. aggtcaggggtggtgtctct atgaa ggaggggcccg .. aa gcccttgtgggcgggcctcccc ......... tgag cccgtctgtggtgccagcc
>GPX3_ratNor_33 .. aagtcaggggtggtgtctcc atgaa ggaggggcccg .. aa gcccttgtgggcgggcctcccc ......... tgag cccgtctgtggtgccagcc
>GPX3_canFam_30 .. gtgtcaggaatggcatctcc atgaa ggaggggccc ... ga agccctcatgggcggacctcccc ........ tgag cctgtctgaagggccggcc
>GPX3_felCat_30 .. gtgtcagggatggcgtctcc atgaa ggaggggccc ... ga agcccttgtgggcggacctcccc ........ tgag cctgtctgaagggccagcc
>GPX3_equCab_26 .. atgtcaggggtggcatctcc atgat ggaggggcccg .. aa gccctggtgggcggacctcccc ......... agag cctgtctgaagggccagcc
>GPX3_bosTau_31 .. tgtcagggggcggcatcgcc atgaa ggaggggcccg .. aa gcccgcgtgggcgggcctccct ......... tgag cctgtctgaggggccagcc
>GPX3_loxAfr_16 .. gtgtcaagagcggcatctcc atgat ggtggggcccg .. aa gcccctgtggcggacctcccc .......... agag cctgtcccatgggccagcc
>GPX3_echTel_13 .. cgtgcagagggagcatctcc atgag ggtgaggcccg .. aa gcccccgtggcggacctcgac .......... ccgag tctgctctgggcctgcctt
>GPX3_monDom_23 .. acataagggatggcatctct atgat ggtgggatcca .. aa gcctcttcagggcgggttccatc ........ agag cctgcaaaaggtgtcagga
>GPX3_ornAna_31 .. aatggggaggtggcatcatc atgac agcggggtctg .. aa agcccctcctggatggaccccgcc ....... cgaa cctgctcggcggtggcatg
>GPX3_anoCar_28 .. gccaaggaagttgcatcact atgag ggttaggtctg .. aa agctcccaaaaagagcggacctagcc ..... tgag gctgcaaagctctggtgta
>GPX3_galGal_31 .. gagcagaggatgacatctcc atgaa ggcctggcctg .. aa agcccccaccatggggtgggctcggcc .... cgat cccgcccaggcgcggtgca
>GPX6_homSap_18 .. atgaagggaagggcatctcc atgat ggtggatccc ... aa aacccctctgggtcgcaccctgcc ....... agag ccttccttggtgcctgtcc
>GPX6_panTro_23 .. atgaagggaggggcatctcc atgac ggtgggtccc ... aa aacctctcggggtcggaccctgcc ....... agag ccttccttggtgcctgtcc
>GPX6_macMul_22 .. cagaagggaggggcatcttt atgat ggtgggtctc ... aa aacctctctgggtcagaccctacc ....... agag ccttccttggtgcctgtcc
>GPX6_cavPor_20 .. ctagaaggaagggtgtctcc atgat ggtgggtccc ... aa aagccctggatcggaccctacc ......... agaa ccttccctggtgcctgtcc
>GPX6_canFam_24 .. tatgaaaggagggcatctcc atgat ggtgggttcc ... ca agcccctgcggtcggaccctacc ........ agag ccttcttgggtgcctgtcc
>GPX6_equCab_25 .. atgagctgaggggcatctcc atgat ggtgggtccc ... aa agcccctgtgggcaggacccaac ........ cagaa ctctgtgcctgtcccttag
>GPX6_bosTau_23 .. atgaggaaaagggcatctcc atgat ggtgggtccc ... aa agcctctctgggtcggaccccacc ....... agag ccttccttggtgcctgtcc
>GPX6_eriEur_24 .. tatgaaaggagggcatctcc atgat ggtgggttcc ... ca agcccctgcggtcggaccctacc ........ agag ccttccttggtgtctgtcc
>GPX6_sorAra_23 .. tgaaaggagggggcatctcc atgat ggtgggtctc ... aa agcccctctgggtcggaccctacc ....... agag ccctgctgggtgtcctgtc
>GPX6_dasNov_20 .. atgaagggagggacatatcc atgat ggtgggtcct ... aa agcccttctgggtcagaccctacc ....... agaa ccttctctggtgcctgtcc
>GPX6_loxAfr_19 .. atgaatggaggggcatatcc atgat ggtgggtccc ... aa agcctctctaggtcggaccctatc ....... agaa tcttccctggtgcctgtcc
>GPX6_echTel_31 .. aatggggaggtggcatcatc atgac agcggggtct ... ga aagcccctcctggatggaccccgcc ...... cgaa ccttccctggtgcctgtcc
>GPX1_homSap_20 .. tctcgggggggttttcatct atgag ggtgtttcctct . aa acctacgagggaggaacacc ........... tgat cttacagaaaataccacct
>GPX1_panTro_20 .. ctgtgggggggttttcatct atgag ggtgtttcctct . aa acctacgagggaggaacacc ........... tgat cttacagaaaataccccct
>GPX1_macMul_26 .. tctctggggggttttcatct atgag ggtgtttcctct . aa acctacaaggaggaacacc ............ tgat aatacagaaaataccccct
>GPX1_otoGar_25 .. tctctgggggggtttcattc atgat agtgttacctct . aa acttgcatgggggaacacc ............ tgat gccccagaaaatcccctga
>GPX1_tupBel_21 .. gcgtctggggggtttcatcc atgac ggtgtctcctct . aa accccgaaggaggaacgcc ............ tgat gtccggaaaaccccccagg
>GPX1_musMus_30 .. ctctggggggcggttcttcc atgat ggtgtttcctct . aa atttgcacggagaaacacc ............ tgat ttccaggaaaatcccctca
>GPX1_ratNor_26 .. ctccggggggaggtttttcc atgac ggtgtttcctct . aa atttacatggagaaacacc ............ tgat ttccagaaaaatcccctca
>GPX1_cavPor_15 .. gctctcctgagggttcttcc atgaa ggtgtttcctctc  aa cctgtatagaggaacatc ............. cgat tcccaggaatttcccagag
>GPX1_oryCun_24 .. gctctctgggggtttcatcc atgag ggcgttcccccg . aa aacaaatggaggaacgcc ............. tgat gtccgggaaacccccaggt
>GPX1_eriEur_19 .. agccgctgggcatctcatcc atgac ggcgccgccttc . aa acctgcgagcaggaaggagcgcc ........ cgat agccgcgagagcccccagc
>GPX1_canFam_22 .. gccctctggggatttcatcc atgat ggtgtttccttg . aa atctgcatggaggaacgcc ............ tgat ttccaggaaagtcccctga
>GPX1_felCat_28 .. gccctctggggatttcatcc atgat ggcgtttcctcg . aa atttgcatagaggaacgcc ............ tgat ttccagaagaatcccctga
>GPX1_equCab_27 .. tttctctggggatttcatcc atgat ggcgtttcctct . aa acatgcatgaggaacgcc ............. tgat gttaaggagaatcccccga
>GPX1_bosTau_30 .. gctctccagggattttgccc atgaa ggtgttccctct . aa acctacgtggaggaatgcc ............ tgat gtccaggaaaatcccctga
>GPX1_dasNov_29 .. tccacacggggttttcatcc atgac ggtgtttcctct . aa acctgcagggaggaacacc ............ tgaa gtccggcaaaatcccccga
>GPX1_loxAfr_25 .. tttccgtgggggtttcatta atgag ggtgttttctct . aa acctgaatggaggaacacc ............ tgat gtctgggaagatacccccc
>GPX1_monDom_26 .. ggtccgtgagggttttatct atgat ggtgttgtttt .. aa accattaaggagaaagaacact ......... tgat aatgcttgtaaaatcccat
>GPX1_ornAna_26 .. ccatgggggagatctcattt atgat ggtgctccttct . aa acctttacggaagagcact ............ tgat ggatcctgaggaactccat
>GPX2_homSap_30 .. aagctctgggccttcacaga atgat ggcaccttcct .. aa accctcatgggtggtgtc ............. tgag aggcgtgaagggcctggag
>GPX2_panTro_30 .. aagctctgggccttcacaga atgat ggcaccttcct .. aa accctcatgggtggtgtc ............. tgag aggcgtgaagggcctggag
>GPX2_macMul_30 .. aagctctgggccttcacaga atgat ggcaccttcct .. aa accctcatgggtggtgtc ............. tgag aggcgtgaagggcctgaag
>GPX2_otoGar_28 .. gggctctgggccttcacaga atgat ggcaccatcct .. aa acgcctctgggtggtgtc ............. tgag aagagcggaaggcctggag
>GPX2_tupBel_29 .. gggctctgagccttcacaga atgat agcaccttcct .. aa acccccccgggaggtgtc ............. tgag aagtgtgacaggcccggag
>GPX2_musMus_34 .. aggttctgggccttcacaga atgat ggcatcttcct .. aa acccttctgggagatgtc ............. tgag aagttgtgaagggtccaga
>GPX2_ratNor_31 .. tgctaggccttcttcacaga atgat ggcatcttcct .. aa acccttctgggggatgtc ............. tgag acgttgtgaagggcccaga
>GPX2_cavPor_20 .. tggctctgggccttcacaga atgac ggcaccgtcct .. aa acgctatgggtggtatc .............. tgag aagtgtgaatggctggagc
>GPX2_sorAra_29 .. aaactctgggccttcgcaga atgat ggcacctccct .. aa atccatggggtggtgtc .............. tgag gcgtgcgagggcctggaaa
>GPX2_eriEur_25 .. ggtttctggaccttcacaga atgat agcaccttcct .. aa acctatagggatggtgtc ............. tgag aaatgtgaagggcctgaag
>GPX2_canFam_23 .. tggctctgggccttcacaga atgat ggcaccttcct .. aa atagtatgggcggtgtc .............. tgag aagtgtgaagggctcagag
>GPX2_felCat_22 .. tggatctgggccttcacaga atgat ggcatcttcct .. aa actgtatgggcggtgtc .............. tgag gagtgtgaagggctcggag
>GPX2_equCab_28 .. aggctctgggccttcacaga atgat ggcaccttcct .. aa acctgtatggacggtgtc ............. tgaa aagcgtgaagggccccgag
>GPX2_bosTau_26 .. gggctctgtgtcttcacaga atgat ggcaccttcct .. aa atctgtatgggcggtgtt ............. tgag aagagtgaaggcctggagc
>GPX2_loxAfr_27 .. aggctctggaccttcgcaga atgat ggcaccttcct .. aa actcagtgggtggtgtc .............. tgag aaatgtgaagggcctaggg
>GPX2_echTel_30 .. tggctctgggccttcacaga atgat ggcaccttcct .. aa accctccggaaggtgtc .............. tgag aaatgtgaagggcctgggg
>GPX2_monDom_26 .. ggtccgtgagggttttatct atgat ggtgttgtttt .. aa accattaaggagaaagaacact ......... tgat aatgcttgtaaaatcccat
>GPX2_ornAna_28 .. agcctccagaccttcacaga atgac ggtgtctcctt .. aa accctaaccgggaggcacc ............ cgag agccggtgaagggcctggt
>GPX4_homSap_29 .. ggagccttccaccggcactc atgac ggcctgcctg ... ca aacctgctggtggggcagacc .......... cgaa aatccagcgtgcaccccgc
>GPX4_panTro_29 .. ggagccttccaccagcaccc atgac ggcctgcctg ... ca aacctgctggtggggcagacc .......... cgaa aatccagcgtgcaccctgc
>GPX4_macMul_33 .. ggagccttccaccggcaccc atgac ggcctgcttgc .. aa accagctcctggtgaggcagacc ........ cgaa aatccagcgtgcaccccgc
>GPX4_tupBel_31 .. gaaccttccacccggcacct ttgac ggtctgcctat .. aa acctgccactggtgaggcagacc ........ cgag aacctggcgtgcaccctgc
>GPX4_musMus_36 .. agccttccaccccggcactc atgaa ggtctgcctg ... aa aaccagcctgctggtggggcagtcc ...... tgag gacctggcgtgcaccctgc
>GPX4_ratNor_34 .. agccttccaccccggcactc atgac ggtctgcctg ... aa aaccagcccgctggtggggcagtcc ...... cgag gacctggcgtgcaccccgc
>GPX4_cavPor_34 .. gagtctcctacccgggtgcc atgac ggcctgcctg ... ca aaccagcgtgctggtggggc ........... agac ccgaggatgcgtgcactgc
>GPX4_canFam_31 .. gagccttccacccggcaccc atgac agtctgtctaa .. aa accagcccgctggtggggcagacc ....... cgag aacccggcgtgcaccctgc
>GPX4_sorAra_37 .. gagccttccacccggcgccc atgac ggtctgcctgc .. aa accagcccgctggtggggc ............ agac ccgagaacccggcgtgcac
>GPX4_echTel_41 .. gagtcttccacccggcacca atgac ggtctgccttc .. aa accaggcctctggtgaggcagacc ....... cgat gacccggcgtgcactcagc
>GPX4_monDom_41 .. gagtcttccacccggcacca atgac ggtctgccttc .. aa accaggcctctggtgaggcagacc ....... cgat gacccggcgtgcacctcag
>GPX4_ornAna_34 .. tcccgggacgctctgcctcc atgac ggccggcctt ... ca agccaaaaccagttggtggggccggcc .... tgaa caaaccggcacgggtcccg
>GPX4_anoCar_39 .. gggccccctcctccagcacc atgac ggcctgccttg .. aa gccagcttgctggtgaggcagacc ....... cgaa gattcggcgtgcactgctg
>GPX4_galGal_39 .. gggccccctcctccagcacc atgac ggcctgccttg .. aa gccagcttgctggtgaggcagacc ....... cgaa gattcggcgtgcactgctg
>SEPW_homSap_36 .. cccctctcagcagacgcttc atgat aggaaggactg .. aa aagtcttgtggacacctggtctttccc .... tgat gttctcgtggctgctgttg
>SEPW_panTro_36 .. cccctctcagcagacgcttc atgat aggaaggactg .. aa aagtcttgtggacacctggtctttccc .... tgat gttcttgtggctgctgttg
>SEPW_ponPyg_31 .. cccctctcagcagacgcttc atgat aggaaggactg .. aa aaatcttgtggacacctggtctttccc .... tgat gttctcgtggctgctgttg
>SEPW_macMul_34 .. cccctctcagcagacgcttc atgat aggaaggactg .. aa aagtcttgtggacgcctggtctttccc .... tgat gttctcgtggctgctgttg
>SEPW_musMus_34 .. cccctcgtggcagacgcttc atgat gggaagaactg .. aa atgtctcgtggacgcctggtctttcc ..... ctgat gtccctgcgactgccacgt
>SEPW_ratNor_27 .. cctttcttggcagccgcttc atgac aggaaggactg .. aa atgtctcaaagacctgtggtctttctt .... cgat gttcctgcggccaccaagt
>SEPW_canFam_34 .. cccctcgtggcagacgcttc atgat gggaagaact ... ga aatgtctcgtggacgcctggtctttcc .... ctgat gtccctgcgactgccacgt
>SEPW_dasNov_29 .. ctgcccttggcagacgcttc atgag gggaaggacct .. aa atgcgtcgtggatgcctggtctttccc .... tgat gctccttcacctgccagat
>DIO1_homSap_29 .. gtgtctttacatatttgttt atgat ggccacagcct .. aa agtacacacggctgtgact ............ tgat tcaaaagaaaatgttataa
>DIO1_ponPyg_29 .. gtgtctttacatatttgttt atgat ggccacagcct .. aa agtacacacggctgtgact ............ tgat tcaaaagaaaatgttataa
>DIO1_macMul_29 .. gtgtctttacatatttgttt atgat ggccacagcct .. aa agtacacacggctgtgact ............ tgat tcaaaagaaaatgttataa
>DIO1_cavPor_24 .. gcttcttttcatatttgttc atgac ggtcacagtct .. aa agtacacacagctgtgacc ............ tgat ttgaaagaaaatgttttaa
>DIO1_bosTau_28 .. gcctcttttcatatttgttc atgac ggccacagcct .. aa agtacacacggctgtgact ............ tgat ttgaaagaaaatgttttaa
>DIO1_sorAra_24 .. gcttctcttcatatttgttt atgac agccccagctg .. aa agtacacacagctgtggct ............ tgat tggaaagaaaatgttttaa
>DIO1_eriEur_26 .. ctttcttctcatatttgctt atgat ggtcacagctt .. aa agtatacacagctgtgact ............ tgat tggaaagaaaatattttaa
>DIO1_ornAna_24 .. ggttccgtgaatattggttt atgag ggtcacagtgt .. aa agcgcatgcagctgtgact ............ tgat ctgagaaaatatttctgcg
>DIO2_homSap_30 .. cagagttgaccagtgtgcgg atgat aactactgacg .. aa agagtcatcgactcagttagtggtt ...... ggat gtagtcacattagtttgcc
>DIO2_macMul_30 .. cagagttgaccagtgtgcgg atgat aactactgacg .. aa agagtcatcgactcagttagtggtt ...... ggat gtagtcacattagtttgcc
>DIO2_musMus_29 .. cagagctcactggtgtgcga atgat aactactgacg .. aa agagctgtctgctcagtctgtggtt ...... ggat gtagtcacacgagtctgcc
>DIO2_ratNor_28 .. cggagctcactggtgtgcga atgat aactactgacg .. aa agagtcatctgctcagtctgtggtt ...... ggat gtagtcacacgagtctgcc
>DIO2_canFam_27 .. cagaggtgaccagtgtgcga atgat aactactgatg .. aa agagtcactgactcagttagtggtt ...... ggat acagtcacattagttttcc
>DIO2_dasNov_27 .. cagaggctaccagtgtgcca atgat aactactgacg .. aa agaggcatcgactcagttagtggtt ...... ggat gtagccacattagtttgcc
>DIO2_monDom_29 .. gaagggctgccagtgtgcaa atgat gatctctaaca .. aa agagtcagtcactccgttagaggtt ...... ggat gtggtcacagtggcttgct
>DIO2_ornAna_25 .. gctgagttactagtgtgcaa atgaa gaccaccaaca .. aa agagaatttaactcagttggtgctc ...... agat atcatcacactggcttact
>DIO2_anoCar_27 .. gcagagctgttggtgtcttt atgaa gatcaccaaca .. aa agagtgtctcattcagttggtgttc ...... agat gtcttagcactggcatttc
>DIO2_galGal_25 .. acctgaatgcttgtgtgttt atgaa gagcactaaca .. aa agagtaattgactcagttggtgttc ...... agat actctcacactggcattcc
>DIO3_homSap_31 .. gcacaggagccccactgctg atgac gaactatctct .. aa ctggtcttgaccacgagctagttc ....... tgaa ttgcaggggcctcaaagca
>DIO3_panTro_31 .. gcacaggagccccactgctg atgac gaactatctct .. aa ctggtcttgaccacgagctagttc ....... tgaa ttgcaggggcctcaaagca
>DIO3_macMul_30 .. gcacaggagccccactgctg atgac gaactgtctct .. aa ctggtcttgaccacgagctagttc ....... tgaa ttgcaggggcctcaaaaca
>DIO3_musMus_26 .. cgctggagccctggctgctg atgac gaaccgcctct .. aa ctgggcttgaccacgggtcggctc ....... tgaa ttgcagagaggctcgaaac
>DIO3_ratNor_26 .. cgctggagccctggctgctg atgac gaaccgcctct .. aa ctgggcttgaccacgggtcggctc ....... tgaa ttgcagagaggctcgaaac
>DIO3_cavPor_24 .. gcgcatgagcccctctgctg atgac gaactgtccct .. aa ctggtctcgaccacgggcgggtt ........ ccgaa attgcaggatggctcgaat
>DIO3_canFam_26 .. gctggcgagccccactgctg atgac gagccgcctct .. aa ctggtcttgaccacgagctggttc ....... tgag ttgcaggggggcttgcagc
>DIO3_felCat_29 .. gctcacgagccccactgctg atgac gagctatctct .. aa ctggtcttgaccacgagctggttc ....... tgaa ccgcagggggcttgcagca
>DIO3_bosTau_23 .. gctcacgagccccactgctg atgaa gagctgtctct .. aa ctggcctcgaccacgagctggttc ....... tgat ttgcaggaggctcgcagca
>DIO3_loxAfr_22 .. gcgctagagccccactgctg atgac gaactgtctct .. aa ctggtcttgaccacgagctgattc ....... cgaa ttgcagggaactcgcagca

Reference sets of 380 vertebrate SECIS elements

Introduction

The comparative genomics of SECIS elements can be investigated at much greater depth in the era of 50 completed vertebrate genomes. The situation currently is unsatisfactory since hardly any SECIS elements have rarely been submitted to GenBank, requiring manual entry from journal graphics prior to the approach described here.

The initial goal is obtaining 2-3 dozen phylogenetically dispersed orthologous vertebrate sequences for each SECIS element in each selenoprotein gene. After that, their evolution can be studied. To date, 380 SECIS elements have been obtained primarily from mammals, tetrapods, and fish. These collections can readily be leveraged to earlier diverging species by locating terminal coding exons and examining downstream sequence via uBlast against the seed set, hopefully in congruence to SECIS web tool motif recognition.

Functionality of a SECIS element depends not so much on its linear nucleotide sequence as its secondary and kink-turn tertiary fold which are experimentally established as critical to recognition by KIAA0256/SECISBP2 binding proteins. As long as hairpins retain complementary bases (perhaps straying intermittantly) and loops retain similar length, this constraint may be satisified without conservation of sequences (except at a handful of key residues).

This poses difficulties in recovering reliably orthologous sequences even in mammalian species (often wholly lacking in experimental transcript data) by blast query alone of an experimentally established fiducial query. Prospective elements might be validated by the SECIS web tool but this can yield both false positives and false negatives.

The approach here exploits the availability of a 30-species multiz whole-genome alignment which also provides a statistically sound PhastCons track quantitating peaks of cross-species conservation, notably in non-coding 3' UTR sequence where metazoan SECIS elements reside. Whole genome alignment methods provide more reliable truly syntenic alignment than ad hoc methods especially in non-coding regions.

It turns out that a rather small fraction of 3' mRNA has any notable PhastCons conservation and that SECIS elements of all human selenoprotein encoding genes reside at a PhastCons peak, whether or not (eg SELM) they are canonical. However the registration is sometimes imperfect, suggesting when the peak is broader that the SECIS element might be larger than the region favored by the SECIS web tool. Typically, 3' UTR of these genes contain other unexplained PhastCons peaks; these may or may not have any specific connection to the selenocysteine aspect of the gene.

Because human -- where the 30-species alignment track resides -- has an exhaustive set of selenoprotein transcripts, it is feasible to retrieve full length post-coding sequence and identify putative SECIS elements using the SECIS web tool. Blatting the identified SECIS elements back into the whole genome establishes that essentially all give unique matches not only within the expected 3' UTR position of the expected gene in correct strand orientation but also to a PhastCons peak.

Further, nucleotide sequences from species other than human, when recovered from the alignment details page for the PhastCons peak, are almost always identified as SECIS elements by the SECIS web tool which is based on PatScan and RNAfold rather than linear sequence homology. This provides independent cross-validation of the validity of the two methods.

Consequently the compilations below are orthologous in the classical sense within each gene. Within gene families, the SECIS elements are then paralogs (related by vertical genetic descent from last common ancestor preceding the gene duplication). However, different selenoprotein gene families may bear no detectable resemblance to each other even at the fold level even when sharing a CxxC motif. Conversely, the SECIS elements of SELM1 and diverged paralog SELM2 are radically diverged at supposedly invariant structural nucleotides.

SECIS elements of non-homologous coding regions could still themselves be homologous provided say an ancestral mobile element distributed a master element to unrelated genes. Alternatively, these elements arose from convergent evolution (perhaps kink-turn starting points were common in 3' UTR for other reasons) and were never orthologous.

This issue cannot be resolved by examining vertebrate (or even metazoan) selenoprotein genes because selenocysteine genes have far more ancient origins. Vertebrates are completely devoid of de novo originated selenoproteins. Their new selenocysteine genes appear to have arisen exclusively by segmental and retrogene duplication mechanisms which bring along the parental SECIS element. Their new selenocysteine sites within genes have arisen exclusively in existing selenocysteine genes that already have a functional SECIS element.

Cautionary note on sequence errors

Cautionary note: using the 30-species genomic alignment track on the UCSC genome browser as sequence source can result in occasional errors, notably when indels occur in other species relative to human and the details page does not provide them. Sequences for other species can be checked directly by Blat in the individual browser for that species.

A second type of error, no SECIS sequence for a given species, can arise when the genomic alignment is missing or incorrect. That data might well be available within the individual browser for that species or within its transcripts. An incorrect alignment results in an irrelevent sequence being offered to the SECIS tool, resulting in no SECIS element being reported. That situation is difficult to distinguish from false negatives associated with the recognition tool.

A third type of error, ascertainment bias, arises from the choice of human genome as reference point for the 30-species alignment. This results in the sequence collection consistenting primarily of placental mammals because other tetrapods and teleost fish are often too diverged to genomically align well.

In other words, despite 4 quality controls currently provided by appropriate location, strand, orthology, and SECIS tool validation, the sequence set would benefit from additional quality controls and supplementation to greater phylogenetic depth. The latter is best done by tblastn of two terminal coding exons of each selenoprotein against NCBI transcripts, followed by SECIS tool applied to the longest 3'UTR. The supplemented set can then be extended, for example to species such as lizard without meaningful transcript collections by Blat of the nearest related species chicken.

It is also feasible to use the trace archives provided a sufficiently close species can provide the SECIS query. The best matches can be validated by blastx against the terminal exon if the trace is sufficiently long (which it often isn't). Here to boost outgroups, a complete set of elephant SECIS elements was obtained from the genome as augmented by traces. Those elephant SECIS elements were then used against sloth, armadillo, tenrec, and hyrax trace archives to obtain fairly reliable sets in those species, totally 85 SECIS sequences with at least two for each selenoprotein. These satisfactorily determine the Atlantogenata node; the rate of evolution of each gene's SECIS element relative to human can then be averaged for the node. These rates are by no means uniform.

Making a comprehensive effort to find SECIS elements in cartilaginous fish results in confirmable SECIS elements in SELS, TXNRD2, and DIO1 for elephantshark (where genomic contigs sometimes extend far enough into 3'utr) and DIO3 in tropical shark. However none of 11 transcripts from 8 other chondrichthyes selenoproteins gave results, in 8 cases because the mRNA was too short and in 3 cases where the mRNA seemed long enough but the presumptive SECIS element could not be recognized by the SECIS tool or by blastn to reference collections because it was too diverged or did not follow the rules:

SEPP1_torCal EH115677 too short 694 714
SEPP2_leuEri EE987575 too short   
SELO_calMil AAVX01333182  too short 556-928
TXNRD2_squAca ES606786 too short
SELU1_squAca too short CX663017 686-693
SELU1_calMil too short AAVX01548610 114-243
DIO2_calMil AAVX01619547 too short 1-187
DIO3_calMil AAVX01619547 too short 1-147

SEPW_squAca EE722256 not too short 314-669 
SEPW_calMil AAVX01059582 not too short 1482-2187
SEPW_torCal EH115680  not too short 319-635 

The easiest approach to finding SECIS elements in teleost fish exploits the presence of a 5-species track in zebrafish that includes the other 4 genomic teleost fish as well as human. This quickly leverages any locatable fish SECIS element to the others. Fish SECIS elements could furnish an important outgroup to tetrapods or alternatively be so diverged they constitute a 'red herring" relative to more conserved earlier diverging chondricthyhians.

SEPP1a: 20 SECIS insertion sequences

>SEPP1a_homSap Homo sapiens (human) score: 30.80
uuuucuuuuu ccagugu ucuauuugcuuua augag aauagaaacgu aa acuaugaccuag ggguuucuguu ggau aauuagc aguuuag aauggaggaa

>SEPP1a_panTro Pan troglodytes (chimp) score: 30.80
uuuucuuuuu ccagugu ucuauuugcuuua augag aauagaaacgu aa acuaugaccuag ggguuucuguu ggau aguuagc aguuuag aauggaggaa

>SEPP1a_macMul Macaca mulatta (rhesus) score: 30.80
uuuucuuuuu ccagugu ucuauuugcuuua augag aauagaaacgu aa acuaugaccuag ggguuucuguu ggau aguuagc aauuuag aauggaggaa

>SEPP1a_tupBel Tupaia belangeri (treeShrew) score: 31.04
uuuucuuuuu ccaguau ucuauuugcauua augaa gacagaaacau aa acuaugaccuag ggguuucgguu ggau agguagc aauuuag aauggaggaa

>SEPP1a_musMus Mus musculus (mouse) score: 32.57
uuuccuuuuu ccagugu ucuaguuacauua augag aacagaaacau aa acuaugaccuag ggguuucuguu ggau agcuugu aauuaag aacggagaaa

>SEPP1a_ratNor Rattus norvegicus (rat) score: 32.57
uuuucuuucu ccagugu ucuaguuacauug augag aacagaaacau aa acuaugaccuag ggguuucuguu ggau agcucgu aauuaag aacggagaaa

>SEPP1a_cavPor Cavia porcellus (guineaPig) score: 34.57
uguucuuuuu ccagaau ucuauuugcauug augaa aacagaaacau aa acuaugaccuag ggguuucuguu ggau acauagu aauuuag aauggaggaa

>SEPP1a_oryCun Oryctolagus cuniculus (rabbit) score: 33.28
uuuucuuuuu ccagcau ucuacuugcauua augau aacagaaacgu aa acuaugaccuag ggguuucuguu ggau aauuagua auuuag aauggagaag

>SEPP1a_sorAra Sorex araneus (shrew) score: 33.08
uuuucuucuu ccaauau ucuauuugcauua augaa gacagaagcaa aa acuaugaccuag gggcuucuguu ggau acuua gcaauugg gauggagaaa

>SEPP1a_eriEur Erinaceus europaeus (hedgehog) score: 33.29
uuuucuuuuu ccagcau ucuacuugcagua augag gacagaaacgu aa acuaugaccuag ggguuucuguu ggau aguuagca auuuag aauggaggaa

>SEPP1a_canFam Canis familiaris (dog) score: 33.38
uuuucuuuuu ccagcau ucuacuugcauua augaa aacagagacau aa acuaugaccuag ggguuucuguu ggau aguuagca auuuag aauggaggaa

>SEPP1a_equCab Equus caballus (horse) score: 29.34
uuuucuuuuu ccagcau ucuacuugcauua augag aacagaaacgu aa acuaugaccuag ggguuucugug ggau aguuagca auuuag aauggaggaa

>SEPP1a_bosTau Bos taurus (cow) score: 30.75
uuuucuuuuu ccaguau ucuacuugcguua augag aacagaaacgu aa acuauaaccuag ggguuucuguu ggau gguuggc aacuaag aauggaggaa

>SEPP1a_dasNov Dasypus novemcinctus (armadillo) score: 33 
UcUUCUUUUU CCAGcaU UCUAUUUGCaUUA AUGAG AAcAGAAACaU AA ACUAUGACCUA GGGGUUUCUGUU GGAU AgUUAGCA aUUUAG AAUGGAGaAA

>SEPP1a_choHof Choloepus hoffmanni (sloth) score: 30
UUUUCUUUUU CCAGcaU UCUAUUUGuaUUA AUGAG AAcAGAAACaU AA ACUAUGACCUAG GGGUUUCUGUU aGAU AgUUAGCA aUUUAG AAUGGAGGAA

>SEPP1a_loxAfr Loxodonta africana (elephant) score: 33 genomic 3'
UcUUCUUUUU CCAGcaU UCUcUUUGCaUUA AUGAG AAcAGAAACaU AA ACUAUGACCUAG GGGUUUCUGUU GGAU AgUUAGCA aUUUAG AAUGGAGGAA

>SEPP1a_echTel Echinops telfairi (tenrec) score: 32.80
ucuucuuuuu ccagcau ucuuuuugcauua augag aacagaaacgu aa acuaugaccuag ggguuucuguu ggau acucugca auuuag aauggaggaa

>SEPP1a_monDom Monodelphis domestica (opossum) score: 31
UGuUUCUCUU CCUGuGU UCUGcUUGCAUUA AUGAA GAcAGAAGCau AA ACUAUAACuUA GGGGCUUCUGUU GGAU AAUUUGCA AUcCAG AAUGGAgGAA

>SEPP1a_macEug Macropus eugenii (wallaby) trace score: 24
UGUUUCUCUU CCUGUGU UCUGUUUGCAUUA  AUGAA  GAGAGAAGCUG  AA  ACUAUAACCUAG GGGCUUCUGUU GGAA AAU UUGCAAG UCAGAAUGGA

>SEPP1a_triVul Trichosurus vulpecula mRNA score: 25 
ugguucucuu ccugcgu ucuguuugcauua augaa gagagaagcug aa acuauaaccuag gggcuucuguu ggau aauuugca auucag aauggaagaa

>SEPP1a_ornAna Ornithorhynchus anatinus (platypus) score: 29
ugccuccugc cguucug cuugcauuu AUGAG AAcAGAAACaU AA ACUAUaaACCUA GGGGUUUCUGUU GGAU AgU UAGCAaU caAGAAUGGg

>SEPP1a_galGal Gallus gallus (chicken) score: 30 T2
UUCUAAUGUU CUGCUUG CAUUU GUGAG GACAGGAGCAU AA ACUAUGACCUA GGGGCUCCUGUU UGAU UUUUUG CAAUCA AGAACAGAAG

>SEPP1a_taeGut Taeniopygia guttata (finch) score: 36
UCUCUUCUAA CAUUCUG CUUGCAUUU  GUGAG  GACAGGAGCAU  AA  ACUAUGACCUA GGGGCUCCUGUC UGAU GUU UUGCAAU CAAGAACAGA

>SEPP1a_anoCar Anolis carolinensis (lizard) score: 32.99
cacuucuacc auucugu uugcauuc augaa aacagaagccg aa acuaugaccuag gggcuuuuguu ugau auauu gcagcca agaacaggag

>SEPP1a_xenTro Xenopus tropicalis (frog) score: 29
UGUUCAUCAC UUGAUUU GUUGCUUGCGUUA  AUGAU  GGCAGAAGCAU  AA  ACUACAAAAUAG GGGCUUCUGUU UGAG UUUGG CAAACAG AAACUGGUGA


>SEPP1a_danRer Danio rerio (zebrafish) score: 32.87
uuucaccucu aagugcu uuauguggucuuu augaa ggcaggugcag aa acuaugcacuag uggugucuguc ugau guuu ggccau acagagcaga

SEPP1b: 16 SECIS insertion sequences

>SEPP1b_homSap Homo sapiens (human) score 20.32
uauauugcuu aguaagu auuuccauaguca augau gguuuaauaggu aa accaaa cccuauaaacc ugac cuc cuuuau gguuaauacu

>SEPP1b_panTro Pan troglodytes (chimp) score 20.32
uauauugcuu aguaagu auuuccauaguca augau gguuuaauaggu aa accaaa cccuauaaacc ugac cuc cuuuau gguuaauacu

>SEPP1b_macMul Macaca mulatta (rhesus) score 20.32
uauauugcuu aguaagu auuuccauaguca augau gguuuaauaggu aa accaaa cccuauaaacc ugac cuc cuuuac gguuaauacu

>SEPP1b_tupBel Tupaia belangeri (treeShrew) score 16.22
uggacugcuu agaaagu auuuccauaguca augau gguucaauaggc aa acuaau cccuauaaacc ugaa cuc cuuuau gguuaauacu

>SEPP1b_oryCun Oryctolagus cuniculus (rabbit) score 15.69
cuuuaggcug cucagag uaucuccauauua augau gguuuaacaggu aa acuaaa cccuaugaacc ugaa uuu cuuuaug gauaauacua

>SEPP1b_sorAra Sorex araneus (shrew) score 15.19
uugguugcuu agaaagu auuuccauaguca augau gguuuaauaggu aa acuuauuu ccuguaaaccc ugaa cuu cuuuau gguuaauacc

>SEPP1b_canFam Canis familiaris (dog) score 16.12
ugauugcuua gaaagua uuuccauaguca augau gguucaauaggu aa acuaag uccuauaaacc ugaa cuccua uaugguu aauacuauua

>SEPP1b_equCab Equus caballus (horse) score 16.12
uugauugcuu agaaagu auuuccauaguca augau gguucaauaggu aa acuaag uccuauaaacc ugaa cuc cuuuau gguuaauacu

>SEPP1b_bosTau Bos taurus (cow) score 13.38
uugauugcuu agaaagu auuuccauaguca augau gguucaauaggc aa accagg uccuauaaacc ugaa uuu uuuuuau ggucaauacu

>SEPP1b_dasNov Dasypus novemcinctus (armadillo) score 14.48
uaggcugcuu agaaagu auuuccauaauca augau gguucaguaggu aa acuaag cccuauaaacc ugaa cuc cuuuau gguuaauacc

>SEPP1b_choHof Choloepus hoffmanni (sloth) score: 16 T2
GCTGCTTAGAAAGTATTTCCATAAT AATGATGGTTCAATAGGTAACCCAAGCCCTATAAACCTGAA CTCCTTTTATGGTTAATAC

>SEPP1b_loxAfr Loxodonta africana (elephant) score 14.36
cuaggcugcu uagaagu auuuccaucauca augau gguucaauaggu aa accaaa uccuauaaacc ugaa cuc cuuaug guuaauacug

>SEPP1b_echTel Echinops telfairi (tenrec) score 17.68
uaggcugcuu agaaagu auuuccauaguua augau gauucauuaggu aa auuua gucuugugaauc ugaa cuc auuuau gguuaauacu

>SEPP1b_monDom Monodelphis domestica (opossum) score 16.17
cagguugcuu agaaagu guucccauaguua augau gguuuaacaggu aa auugac uccuguggacc ugaa cuc uuuuau gguucauacu

>SEPP1b_macEug Macropus eugenii (wallaby) trace score: 18
CAGGUUACUU AGAAAGU AUUCCCAUAGUCA  AUGAU  GGUUCAGUAGGU  AA  AUUUAC UUCUAUGGACC UGAA CUC UUUUAU GGUUAAUACU

>SEPP1b_ornAna Ornithorhynchus anatinus (platypus) score 17.91
gaauggcuua gaaagua uuugccauaguua augac gguucaguaggg aa auccaa uccuaugaacc ugag cucuuc uaugguu aaugcuaaua

>SEPP1b_galGal Gallus gallus (chicken) score: 30 GTGA
UGUUUCUCUU CUAAUGU UCUGCUUGCAUUU  GUGAG  GACAGGAGCAU  AA  ACUAUGACCUA GGGGCUCCUGUU UGAU UUUUU GCAAUCA AGAACAGAAG

>SEPP1b_taeGut Taeniopygia guttata (finch) score: 36
UCUCUUCUAA CAUUCUG CUUGCAUUU  GUGAG  GACAGGAGCAU  AA  ACUAUGACCUA GGGGCUCCUGUC UGAU GUU UUGCAAU CAAGAACAGA

>SEPP1b_anoCar Anolis carolinensis (lizard) score 16.09
ugcuuagauu gugcuug ccauaguuc augau gguuuauuaggg aa auaaa uucuacaaaacc ugaa uuccu uuauggu gaacacagaa

>SEPP1b_xenTro Xenopus tropicalis (frog) score: 14
GGTGATGGGCTGCATTGTTAGTAAATGCTATA ATCAATGACGGTTTCTAGGGAAACAAACTCCTACATAAC CTGAATAAACCTATATGGCATTGCTAAGTAGC

>SEPP1b_xenTro Xenopus tropicalis (frog) score: 30
UGUUCAUCAC UUGAUUU GUUGCUUGCGUUA  AUGAU  GGCAGAAGCAU  AA  ACUACAAAAUAG GGGCUUCUGUC UGAG UCUGG CAAACAG AAACUGGUGA

>SEPP1b_danRer Danio rerio (zebrafish) score 24.26
auagaugguu uuaaaca uuuuuuauacuua augaa gguuuucuggu aa aucuuguauc accuggaagac ccgag aaac uguaugg aaauguaugc

SEPN: 14 SECIS insertion sequences

>SEPN_homSap Homo sapiens (human) score: 32.06
caguggcuuc cccggca gcagcccc augau ggcugaauccg aa auccucga uggguccagcu ugau guc uuugcag cugcaccuau

>SEPN_panTro Pan troglodytes (chimp) score: 32.06
gcaguggcuu cccuggc agcagcccc augau ggcugaauccg aa auccucga uggguccagcu ugau gucuuu gcagcug caccuauggg

>SEPN_macMul Macaca mulatta (rhesus) score: 32.06
caguggcuuc cccagca gcagcccc augau ggcugaauccg aa auccucga uggguccagcu ugau guc uuugcag cugcaccuau

>SEPN_musMus Mus musculus (mouse) score: 34.87
guggcucccc cagcaac agccgc augau ggcugggucug aa aucgcaaa uggauccagcc ugau guccuc gcaguug cacauguggg

>SEPN_ratNor Rattus norvegicus (rat) score: 35.19
gguguuuccc ccagcag cagccgc augau ggcugggucug aa aucccaaa aggauccagcc ugau guccucg caguug cacauguggg

>SEPN_cavPor Cavia porcellus (guineaPig) score: 34.85
gaauaaugau ccccgag cagcagcccc augau ggcuggauccg aa auccuaga uggaucuagcu ugau gcc uuugcag uugcacuuau

>SEPN_sorAra Sorex araneus (shrew) score: 33.75
ggcuuuuccc cacccgc aaccgccuc augau ggcuggaucug aa auccuaga uggaucuggcu ugau gucuuu gcgauug uccuguggga

>SEPN_canFam Canis familiaris (dog) score: 34.73
ggcagugucu cccgcag cagcagcccc augau ggcuggaucug aa auccuaga uggguccagcu ugau guc uuugcag cugcaccuac

>SEPN_felCat Felis catus (cat) score: 28.82
cggugucucc cccagca gcagcccc augau ggcuggaucug aa auccuaga cgggcccagcu ugau guc uuugcag cugcaccugu

>SEPN_equCab Equus caballus (horse) score: 37.53
ggagggacaa uggcucc ucgcggcugcccc augau ggcuggaucug aa auccugga uggguccagcu ugau gucuc cgcaguug caccuauggg

>SEPN_bosTau Bos taurus (cow) score: 31.65
cgauggugcc cccuagc agccgcccc augau ggcuggaucug aa agcuuagg uggauccagcu ugau gucuuu gcaguug cuccuguggg

>SEPN_dasNov Dasypus novemcinctus (armadillo) score: 26.61
gccgcuggcu ccuccag cagccgccgc augaa ggauggaucug aa aucccaga uggauccagcc cgau cuc uuugcag uugcaccugu

>SEPN_loxAfr Loxodonta africana (elephant) score: 31.75
agugaugguu ccccaag caacugcccc augac agcugggucug aa auccuaga uggacccaguu ugau guc uuugcag uagcaccucu

>SEPN_monDom Monodelphis domestica (opossum) score: 26.99
gggacuucua uucuccu gcaacuguucuuu augau ggcuagauccu aa auccuaga ugggucaaguu ugau gucuug acaguaa cugaagggga

>SEPN_macEug Macropus eugenii (wallaby) trace score: 34
AUUUCUGUUC UCUGCCU GCAGCUGUUCUUU  AUGAU  GGCUUGGUCCU  AA  AUCCCAGA UGGGUCAAGCU UGAU GUCUUCUU GACAGUA ACUGGAAAGG

SEPHS2: 11 SECIS insertion sequences

>SEPHS2_homSap Homo sapiens (human) score: 20.81
accugcaacc aucugac uuggucucuguua augac gucucucccucu aa accccauuaagg acugggagaggc agag caag ccucaga gcccaggccu

>SEPHS2_panTro Pan troglodytes (chimp) score: 20.81
accugcaacc aucugac uuggucucuguua augac gucucucccucu aa accccauuaagg acugggagaggc agag caag ccucaga gcccaggccu

>SEPHS2_macMul Macaca mulatta (rhesus) score: 20.90
accugcaacc aucugac uuggucucuguua augac gucucucccucu aa acuccauuaagg acugggagaggc agag caag ccucaga gcccaggccu

>SEPHS2_otoGar Otolemur garnettii (bushbaby) score: 11.55
ccuaccagca ucugacu ucaucucugcug augac auuucucccuug aa aggcuac uaagggcaggg agaa gcagagga aguccca gcgcgcaggc

>SEPHS2_musMus Mus musculus (mouse) score: 22.00
aagacuagcc accugac uuggucucugaua augau gucucucccucu aa cucccaguaagg acugggagaggc ugaa caaac cucagag ccaggugucg

>SEPHS2_ratNor Rattus norvegicus (rat) score: 18.62
cagccaucua acuuggu cucuguua augac gccucucucugu aa accccacuacgg acugggggaggc agag caa acccag agcccaggcu

>SEPHS2_canFam Canis familiaris (dog) score: 20.27
ccugcaacca ucugauu uggucucuguua augac guuucucccucu aa accccuuuuagg acugggagaggc agag uaagccccag agcccaa accucagugg

>SEPHS2_felCat Felis catus (cat) score: 22.33
ccugcgacca ucugauu uggucucuguua augac gucucucccucu aa accccuuuaagg acugggggaggc agag caagccccag agcccaa gccuugaugg

>SEPHS2_equCab Equus caballus (horse) score: 21.57
ccugcagcca ucugacu uggucucuguua augac gucucucccucu aa accccguuaugg acugggagaggc agag caagccccag agcccagg ccuugguggu

>SEPHS2_bosTau Bos taurus (cow) score: 22.19
uccagccacc uuacuug gucucuguua augac gucucucucua aa ccccuuuaagga cugggagaggc agac caaac cccagag accaggauuu

>SEPHS2_dasNov Dasypus novemcinctus (armadillo) score: 17.60
acccguaacc accuggc cuggucucuguua augau guuucucccucu aa accccguuaagg acugggagaggc ggag ugagc cccagag cccaggccuu

>SEPHS2_choHof Choloepus hoffmanni (sloth) score: 16
ACCUGUAACC AUCUGGC CUGGUCUCUGUUA AUGAU GUUUCUCCCUUUG AA CCCCAUUCA GGAUGGGGAGAGGC AGAC CGAG CCCCAGA ACCCAGGCCU 

>SEPHS2_loxAfr Loxodonta africana (elephant) score: 20 traces lacking coding
AUCUGUAACC AUCUGAC UUGGUCUCUGUUA AUGAU GUUUCUCCCUCU AA ACCUCAUUAAG GACUGGGAGAGGC AGAG CAAG CCUCAGA GCCCAGGCCU

>SEPHS2_echTel Echinops telfairi (tenrec) score: 22 T2
ATCCGGAACCATCTGACGTGGTCTCTGTT AATGATGTTTCTCCCTCAAAACCCCGTGAAGGACCGGGAGAGACGGAG CAAATGCCAGAGCCCAGGCCT

>SEPHS2b_monDom  Monodelphis domestica (opossum) score: 23 T2 inconsistent
CATCTCGCTGATCATAGGCCTTGG CTCTGTTTATGATGCTTCTCCCtcta aacctctttgagggctggatgaagc 

>SEPHS2a_monDom  Monodelphis domestica (opossum) score: 32
UGCUAACCAC AAGCCUU GUCUCUGUUU  AUGAU  GCUUCUCCCAU  AA  AACCCUAUUAAGG GCUGGGAGAGGC UGAG CAAAACCUC AGAGUCU AGGCCUUGGU

>SEPHS2ab_macEug Macropus eugenii (wallaby) trace score: 30 id issues
UCUGCUAACC UUGCCUU GUCUCUAUUU  AUGAU  GCCUCUCCCAU  AA  AACCCUAUCAAGG GCUGGAAGAGGC UGAG CAAAACUUCA GAGCCUA GGCCUUGGUG

>SEPHS2_ornAna Ornithorhynchus anatinus (platypus) score: 23
CUCUGCGGAC CCCAGGC CUAGUCUCUGUUC  AUGAC  GCGUCUCCCGUC  AA  ACCCCGUUAAAGG GCCGGGAGAGGC UGAG GCAACCC CCAGAGG CUAGGCCcga

SELM1: 18 SECIS insertion sequences

>SELM1_homSap Homo sapiens (human) score 27.34
agagugaaac auucaca aagauuugcguua augaa gacuacacaga aa accuuucuaggga uuuguguggau cagau acauac uuggcaa auuuuugagu

>SELM1_panTro Pan troglodytes (chimp) score 27.93
agagugaaac auucaca aagauuugcguua augaa gacuacacaga aa accuuucuaagga uuuguguggau cagau acauac uuggcaa auuuuugagu

>SELM1_macMul Macaca mulatta (rhesus) score 27.71
agggugaaac auucaca aagauuugcguua augaa gacuacacaga aa accuuccuaagga uuuguguggau cagau acauac uuggcaa auuuuugagu

>SELM1_otoGar Otolemur garnettii (bushbaby) score 28.3
gaaacauuca caaaaau uugcauua augaa gacuacacaga aa accuuucagagga uuuguguggau cugau acuuggc aaauuuug aguuuuauau

>SELM1_tupBel Tupaia belangeri (treeShrew) score 24.54
agagggaaac auucaca aagauuugcguua augaa gacugcacaga aa accuuucuaggga uuuguguggau ccgau aau uggcaaa uuuuuguauu

>SELM1_musMus Mus musculus (mouse) score 35.23
aauuuaauac uuauaaa gguuugcauua augag gauuacacaga aa accuuuguuaagga cuuguguagau cugau aauuggcaaa uuuuua uuuuaaaagu

>SELM1_ratNor Rattus norvegicus (rat) score 30.11
aauguaauac uuauaaa gguuugcauua augag gauuacacaga aa accuuuguuaaggg uuugugucgau cugau aauuggcaaa uuuuua uuuuuaaaau

>SELM1_cavPor Cavia porcellus (guineaPig) score 31
gaaugaaaug gccacaa aaacuugcauua augag gacuauacaga aa accuuccuaagga uuuguauagau cugau guauggcaaa uuuuugu uuuuacauuc

>SELM1_sorAra Sorex araneus (shrew) score 25.76
uaagaauaau uugcaca aagauucgcauua augaa ggcuacacagg aa accuuacuaagga uuuguguggau cugau aac uagcaa auuuuugugc

>SELM1_eriEur Erinaceus europaeus (hedgehog) score 26.92
uagcaguacu cacaaag guuugcaucc augaa ggcuacauaga aa accuuacugagga uuuguguagau cugau gcucagcaaa cuucug uguuuuacag

>SELM1_canFam Canis familiaris (dog) score 27.8
agaguaucuu cacagag auuugcauua augaa gacuacacaga aa accuucaggagga uuuguguggau cugau auuuagcaa aauuuug uguuucacac

>SELM1_felCat Felis catus (cat) score 30.14
gagggaaaca uucacaa cgauuugcauua augaa gacuacacaga aa accuucaugagga uuuguguggau cugau gaua uuuagca aauuuuugug

>SELM1_equCab Equus caballus (horse) score 28.65
agugaaacau ucacaaa gauucgcguua augaa gacuacacaga aa accuuucugagga uuuguguggau cugau auccggcaaa uuuuug ugcuuuacau

>SELM1_bosTau Bos taurus (cow) score 23.97
gugaaauauu cacacaa agauuugcauua augaa gacuacacaga aa accuuccugagga uuuguguggac cugau acuuagcaaa uuuuug ugcuuuacau

>SELM1_dasNov Dasypus novemcinctus (armadillo) score: 24
AGUGAAACAU UuACAAA GAUUUGCacUA AUGAA GACUACACAG AA AACCUUUCUAaGGAU UUGUaUGGAU CuGAU AuUUGGCAAA UUUUUG uGUuuuccac

>SELM1_choHof Choloepus hoffmanni (sloth) score: 25
AGAGUGAAgC AUUCACA AAGAUUUGCacUA AUGAA GACUACACAGA AA AuCUUUCUAaGGg UUUGUGUGGAU CuGAU AuU UGGCAAA UUUUUGuGUu

>SELM1_loxAfr Loxodonta africana (elephant) score: 27 genomic 3'
AGAGUGAAAC AUUCACA AAGAUUUGCaUUA AUGAA GACUgCACAGA AA ACCUUUgUAaGGA UUUGUGUGGAU CuGAU AuU UGGCAAg UUUUUGuGUu

>SELM1_echTel Echinops telfairi (tenrec) score: 20 T2
AGAATGAAACATTCACAAAGATCGCGT AATGAAGACTACCCAGAAAACTTTGTAGATTTGTGTGGATCTGAT ATTTGGCAAATTTTGTTTT

>SELM1_monDom  Monodelphis domestica (opossum) score: 22 T2
TGTGAAACATGAAGACAATGCGCAT TAATGATGACTACACAGAAAACCTATCATGGGCTTGTGTAAATCTGA TGTTTAGTGTATT

>SELM1_ornAna Ornithorhynchus anatinus (platypus) score 26.78
gacugugaaa caugaag acaaugcgcauua augau gacuacacaga aa accuaucaugga uuuguguauau cugau guuu cguguau uuccucaguu

>SELM1_galGal Gallus gallus (chicken) score: 23
aaacauuugg uaagcac acuuua  gugaa  gacugcauag  aa  aaccucugaggu augugcuaguc agau guca ggugug cuuugcauca

>SELM1_taeGut Taeniopygia guttata (finch) score: 17
AAACAUUUAG UAGGUAC ACUUUA  GUGAA  GACUACAUAG  AA  AACCUCUGAGGU GUAUG-AAGUC AGAU GUCA GGUGUG CUUUGCAUCA

>SELM1_anoCar Anolis carolinensis (lizard) score 31.51
gauuggagga ugccagc aaaauacucuuua augau gacuacaugua aa gccuuuaacaaaagg cauguguaggu cugau guca gaugua cuuuuguuaa

MSRB1: 14 SECIS insertion sequences

>MSRB1_homSap Homo sapiens (human) score: 26.23
ccugccagcc gcccugg cccuggucacugc augau ccgcucugguc aa acccuuccaggcc agccagagugg ggau ggu cugugac cugcugggaa

>MSRB1_panTro Pan troglodytes (chimp) score: 23.19
ccugccagcc gcccugg cccuggucacugc augau ccgcucugguc aa acccuuccaggcc agccagggugg ggau ggu cugugac cugcugggaa

>MSRB1_macMul Macaca mulatta (rhesus) score: 22.02
ccugccagcc gcccugg cccuggucacugc augau cugcucugguc aa acccuuccaggcc agccagcgugg ggau ggu cugugac cugcugggaa

>MSRB1_otoGar Otolemur garnettii (bushbaby) score: 25.09
uuggccaucu gcuccag cccaagucaaugc augau cuccucuggcu aa auccuuccaggcc agccagggugg ugau guc ugugacc ugcuggggga

>MSRB1_musMus Mus musculus (mouse) score: 23.75
ccugccaacc gcuccag ccucagucaccga augau cugcucugguc aa auccuucuaugcc agccagggugg ugau gac ccgugac cuuugaggag

>MSRB1_ratNor Rattus norvegicus (rat) score: 21.64
cuggccaacc acuccag ccucagucacugu augau cugcucugguu aa auccuucugugcca gcccagggugg ugau gaccugugac cuucgag gagggaggcg

>MSRB1_cavPor Cavia porcellus (guineaPig) score: 26.14
augaccagcu gcuucag cccuggucaaugc augau cuacucuggcu aa auccuucuaggcc agucagggugg ugau gau cugugac cugcugggga

>MSRB1_oryCun Oryctolagus cuniculus (rabbit) score: 28.41
auuggccccc gccccgg ucacugc augac ccgcucuggcu aa acccuuccagggc agccagggugg ugau ggu cugugac cugcggcggg

>MSRB1_canFam Canis familiaris (dog) score: 28.62
guugcuggcu gcugcag cugcagucacuac augau ucacucugguu aa acccuuccaggc agccagagugg ugau gau cugugac cugcuagagg

>MSRB1_felCat Felis catus (cat) score: 31.99
cucgccggcu gcuccgg cccuggucacuac augau ucacucugguc aa agccuuccaggc agccagagugg ugau gau cugugac ggcuggaggg

>MSRB1_equCab Equus caballus (horse) score: 24.02
cccagccggc ugcucca gcccagucacugc augau ucacucuggug aa acccuucggggc ggccagagugg ugag gaccug ugacccg cuggaggagc

>MSRB1_bosTau Bos taurus (cow) score: 27.78
ugccagcugc cccagcc cagucacucu augau ucucucuggcu aa acccuugcaggc agccagagugg ugau gacccgugac ccgcuggg ggagcaggcg

>MSRB1_loxAfr Loxodonta africana (elephant) score: 16 genomic 3' called SEPX1
CCGACCAGCU GCUCCAG CCCUGGUCACUGC AUGAU UCGCUCUCGUU AA ACCGUUCCAGGCC CACCAGGGUG CUGAU GGU UCGUGAU CCACUAGGAG

>MSRB1_echTel Echinops telfairi (tenrec) score: 14
CCCAGUCAGC GGCUCCA GCCCGGUCACUGC  AUGAA  UCGCUCUGGUC  AA  AUCCUUCCAGGCUC ACCAGGGUAC UGAU GGUC UGUGACC UGCUGGGGCA

>MSRB1_monDom  Monodelphis domestica (opossum) score: 21
UUUCCUGUUA CUUUGGU UUGGGGUCACAGU  AUGAA  UUGCCCUGGUU  AA  ACCCUUAUAGGAU GGCCAUGGUGA UGAA GGUUAGU GACCAGG CCAGAAAACG

>MSRB1_macEug Macropus eugenii (wallaby) trace score: 25
UAUCCUGUUA UUUUGGC UUGGGGGCACGGU  AUGAA  UUACCAUGGUU  AA  ACCCCUGCAGGAU GGCCAUGGUGA UGAA GGUCA GUGACCA GGCCAGAAAA

>MSRB1_ornAna Ornithorhynchus anatinus (platypus) score: 26.32
ucugccccuc cccaccu gguuuucagcauu augac ucgcccugggg aa agcccuccuggag cgccagggcga cgau ggucaccu gaucggg ugggcaggga

>MSRB1_galGal Gallus gallus (chicken) score: 22
ucuggugcua uucuggg cugggaucauggu augaa uuguccucugu aa auccuccugggau gcgagggugg ggau guu uuguga uccugcugga

>MSRB1_taeGut Taeniopygia guttata (finch) score: 23
CCUGGAGCUA UUCUGGG CUGGGAUCAUGGU  AUGAA  CUGCCCUAUAU  AA  ACCCUCCAGG GCGCUGGGGCAG GGAU GUU UUAUGG UCCCACAUGU

TXNRD1: 17 SECIS insertion sequences

>TXNRD1_homSap Homo sapiens (human) score: 25.36
auuuggcagg gcaucga agggaugcaucc augaa gucaccagucuc aa gcccaugugg uaggcggugau ggaa caacug ucaaauc aguuuuagca

>TXNRD1_panTro Pan troglodytes (chimp) score: 25.36
auuuggcagg gcaucga agggaugcaucc augaa gucaccagucuc aa gcccaugugg uaggcggugau ggaa caacug ucaaauc aguuuuagca

>TXNRD1_otoGar Otolemur garnettii (bushbaby) score: 23.42
aucggcagug caucgac gggaugcgucc augaa gucaccagccuc aa gccugugugg ugggcagugau ggaa caacu guccaau caguuucuau

>TXNRD1_tupBel Tupaia belangeri (treeShrew) score: 25.13
ucuuggcagc gcaucag agggaugcgucc augaa gucaccagccuc aa gcccgugcgg ugggcggugau ggaa cgacug ccagauc aguuucagca

>TXNRD1_musMus Mus musculus (mouse) score: 27.9
aucuggcaga gcaucac aggcaugcgucc augaa gucacuggccuc aa gcccaagug gugggcagugac agaa gagcu gccgggu cuguugagcu

>TXNRD1_ratNor Rattus norvegicus (rat) score: 28.03
uucggcagag caucacg gugcgucc augaa gucacuagccuc aa gcccaagugg ugggcagugac agaa agc ugucgau cuguuggguu

>TXNRD1_cavPor Cavia porcellus (guineaPig) score: 23.88
gcggcggcac cguaggg ugcgucc augag gucaccagccuc aa gcccgaggg ugggcggugac ggau cgc gccgcg uggcucagcu

>TXNRD1_eriEur Erinaceus europaeus (hedgehog) score: 26.25
ugucagcaga gcaucaa agggaugcgucc augaa gucaccagccuc aa gcccgugcggg ugggcagugac ggaa cacug ucgaagc aguuucaaca

>TXNRD1_canFam Canis familiaris (dog) score: 24.54
auucggcaug caucggc guggugcgucc augaa gucacuggccuc aa gccaugcg gugggcagugau ggag caac ugucgag caguuuuagu

>TXNRD1_felCat Felis catus (cat) score: 24.14
acucggcagc gcaucgg agggcgcgucc augaa gucaccggcccc aa gcccccgcg gugggcggugau ggaa caagu gccgagc aguuuuagcg

>TXNRD1_equCab Equus caballus (horse) score: 21.76
acucggcagu gcaucga agggaugcgucc augaa gucacuggccuc aa agcccaugug gugggcggugau ggaa cagcug ucgaagc aguuuuagca

>TXNRD1_choHof Choloepus hoffmanni (sloth) score: 16
GUUUGGCAGU GCAUCUU UGGGAUGCGUCC  AUGAU  GUCACCGGCCUC  AA  GCCCGUGAGG AUGGGCAGUGAU GGAA CAUCU GUCGAGU CUUUUUUUAG

>TXNRD1_loxAfr Loxodonta africana (elephant) score: 23 genomic 3'
gauaUUGGCA GcGCAUC GAGGGAUGCAUCC AUGAA GUCACugGcCUC AA GCCCAUGUG GggGGCGGUGAU GGAA CAgCUGUCg AAUCAGc uuuggcauga

>TXNRD1_echTel Echinops telfairi (tenrec) score: 19.5
guggcagugc aucaaga gaugcguuc augaa aucgcuugcccc aa gcccga guggcgggcag cgau ggaaca ucugucu caucaguuuc

>TXNRD1_monDom  Monodelphis domestica (opossum) score: 23 VFTTLSVTKRSGGSILQAGCcG
GGCUCGCGGU GCAUCGG UGAGAUGCGUUC  AUGAA  GUCGCUGCCUG  AA  GCCCAUAUCCCGUGG UGGGUGGUGAC CGAA AGAACCG CCGGCC UCCGUUUUAU

>TXNRD1_macEug Macropus eugenii (wallaby) trace score: 21
GGUCUCGUGG UGCAUCC AACAGAUGCGUUA  AUGAA  GUCACUACCUAG  AA  GCCUGUAUCUUGUG GUGGGUGGUGAC CGAA GAGCCACU GCCAUCA GUUUUAUCAA

>TXNRD1_ornAna Ornithorhynchus anatinus (platypus) score: 18.89
aggagugcac ccaaggg cugcauuu augaa gucagagccaa aa gccagcauuuugcgg uuggcugugau ggaa aaa cuccug ccacaguuuu

>TXNRD1_galGal Gallus gallus (chicken) score: 26.64
uagcagggca uuucaca caugcuuuc augaa aucacagccug aa gccugcacugucugg ugggcagugau ggaa gaacu gcugaca cagcugaaca

>TXNRD1_taeGut Taeniopygia guttata (finch) score: 27
CUGUCAAGUU GGUGAUU AGCAGGGCAUUUA  AUGAA  UGCCUCCAUG  AA  GUCAUAGCCUGAAGCCUGCAUUGUC UGGUGGGCA GUGAU GGA AGAACU GCUAGCACAG

>TXNRD1_anoCar Anolis carolinensis (lizard) score: 32.53
uggcaaggca uuguuca agaugcuucc augaa gucacagucua aa accagugcuuucugg uaggcagugau ggaa aga uugcugg cacaacuuga

TXNRD3: 9 SECIS insertion sequences (problematic)

>TXNRD3_homSap Homo sapiens (human) score: 19.10
gacagcgaga agcagug ggacugcuucc uugac gccuuagcuu gg agccccguuaugaggu gagccaaggc ugac ucu cgcaagc caggacugag

>TXNRD3_panTro Pan troglodytes (chimp) score: 19.10 
agcagugggc GACAGCGAGA AGCAGUG GGACUGCUUCC UUGAC GCCUUAGCUU GG AGCCCCGUUAUGAGGU GAGCCAAGGC UGAC UCU CGCAAGC CAGGACUGAG

>TXNRD3_macMul Macaca mulatta (rhesus) score: 17.86 
GACuGCGAGA AGCAGUG GGACUGCUUCC UUGAC GCCUUAGCUU GG AGCCCuGUUgUGAGGU GAGCCAAGGC cGAC UCU CGCAAGC CAGGACUcAG

>TXNRD3_calJac Callithrix jacchus (marmoset) score: 25.26 
GACuGCGAGA AGCAGUG GGACUGCUUCC UUGAC GCCUUAGCUc Ga AGCCCuGUUAcGAGGU GAGCCAAGGC UGAu UCU CGCAAGC gAGGACUGAG
>TXNRD3_dasNov Dasypus novemcinctus (armadillo) score: 21 T2
GACTTGGAGAAGCAGTTAGACTGCTTT CTTGACGTCTTAGCTCGGAGCCTGCATGAGGTGAGCTAAGACTGAC TCTCCTGAAGTCAG

>TXNRD3_choHof Choloepus hoffmanni (sloth) score: 24
GACTTGGAGAAGCAGTTAGACTGCTTG CTTGACGTCTTAGCTCGGAACCCCAGCGTGAGGTGAGCTAAGACTGAC TCTCCTGAAGTCAG

>TXNRD3_loxAfr Loxodonta africana (elephant) score: 21 T2 extended trace of last exon but no genomic
GACTTGGAGAAGCAGTTA GACTGCTTTCTTGACGTCTTAGCTCGGAGCCTGCATGAGGTGAGCT AAGACTGACTCTCCTGAAGTCAG

>TXNRD3_monDom Monodelphis domestica (opossum) score: 28
CCUUGGAaAA GCAuUaA ucCUGCUuUC UUGAc GUCAUAGCUCAG AA CCCUAUUGUGA GGUGAGCUAUGaC UGAU GAUUuCCU UGCAAGU CAGGACcccu

>TXNRD3_macEug Macropus eugenii mRNA score: 28
cuuccuugga gaagcag ugacgcugcuguc uugau gucauagcucag aa cccuauuguga ggugagcuauggc ugau gauu cccuugc aagucaggac

>TXNRD3_ornAna Ornithorhynchus anatinus (platypus) score: 19
AGGAGUGCAC CCAAGGG CUGCAUUU  AUGAA  GUCAGAGCCA  AA  AGCCAGCAUUUUGCGGU UGGCUGUGAU GGAA AAA CUCCUG CCACAGUUUU

>TXNRD3_galGal Gallus gallus (chicken) score: 27
UUUGCUUGGU AUCAGCA CUAAUGUGCUUUU  UUGAC  GUUCUGGCUCGG  AA  CCUUACUCUGAG GUGAGCUAUGAC UGAU GGC UGCCAU GCAAGGUUGG

>TXNRD3_taeGut Taeniopygia guttata (finch) score: 28
UUUGCUUGCA AUUAGCA CUGCGGUGCUUUU  UUGAC  GUUGUUGCUCGG  AA  CCUUCCUGUAAG GUGAGCUACAAC UGAU GGC UGCCAG GCAAGGCUGG

>TXNRD3_anoCar Anolis carolinensis (lizard) score: 24 T2
atattgactttcttagaagagcacgcaagtGTA TTTTTGAAGTTTTGGCTCTGAACCCCAATTGGAGGCGAGTCATgacg acggatgacttctatgcaaagttgggaaaaccaattcgtccaa

TXNRD2: 11 SECIS insertion sequences

>TXNRD2_homSap Homo sapiens (human) score: 31.00
cacccccccc caggcuc cuggugccagaug augac gaccugggugg aa accuacccugugg gcacccauguc cgag ccccc uggcauu ucugcaaugc

>TXNRD2_panTro Pan troglodytes (chimp) score: 31.00
ggcacccccc caggcuc cuggugccagaug augac gaccugggugg aa accuacccugugg gcacccauguc cgag ccccc uggcauu ucugcauugc

>TXNRD2_tupBel Tupaia belangeri (treeShrew) score: 36.55
cucccucccc aggcccc cgaugccagaug augac ggccuggacag aa acccacccuguggg cugcccagguc ugaa cccuccc uggugucu uuggggugua

>TXNRD2_musMus Mus musculus (mouse) score: 36.94
gccagccucu gacacuc ccagcgucagaug augau ggccugggcag aa accccauguggg ccgcccagguu ugaa ccccu ggcauuu cuagagcacu

>TXNRD2_ratNor Rattus norvegicus (rat) score: 34.71
cagccuucac acacugc cagugucagaug augac ggccugugcag aa acccccacguggg cugcccagguu ugaa ccccug gcauuu cuggagugcu

>TXNRD2_cavPor Cavia porcellus (guineaPig) score: 34.41
ucuggccccc caggucc ccagugccaguug augau ggccugggcag aa acccacccuguggg caguccauguc ugaa cuccc uggcauu ucuggagugc

>TXNRD2_eriEur Erinaceus europaeus (hedgehog) score: 34.68
ccagccccac caggccc ccgaugccagaua augau gacuugugcag aa acccacccggg cugcccauguc ugag ccucug uggcauu cuggagugua

>TXNRD2_canFam Canis familiaris (dog) score: 34.36
accagccccg ccaggcc ccgaugccagaag augac gacgugugcag aa accccccuguggg cugcccgcguc cgag cccccuggc guuucugg aauguaaaua

>TXNRD2_equCab Equus caballus (horse) score: 31.37
ccagcccugc cagguuc ccgaugccagacg augac gaccugcgcgg aa acccacccuguggg cugcccacguc cgag ccccc uggcauu ucugaagugc

>TXNRD2_loxAfr Loxodonta africana (elephant) score: 31 genomic 3'
AGCCAGCCCA GCGGCCC CCAGUGCCAGAUG AUGAC GACCUGCGCAG AA ACCCACCCUGUGGG CUGCCCACGUU UGAG CCCCC UGGCAUU UCUGGAGUGC

>TXNRD2_echTel Echinops telfairi (tenrec) score: 37.41
cccuugcccc caccuca gcgccagaug augaa gacaugugcag aa acccagcccguggg cugcccauguc ugag ccccc ugacgu uucuggagug

>TXNRD2_monDom  Monodelphis domestica (opossum) score: 34
CAGCCCUCCU CCGUGUC CACAUGCCAGAUC AUGAC GACUUGCGCAG AA ACCCACCCGUGGG CCGCGCAAGGC CGAG CUCUCCU GGCAUU UCCAGUGCAU

>TXNRD2_macEug Macropus eugenii (wallaby) trace score: 31
CAACUCCCAU UUGUGUC CAAAUGCCAGAAC  AUGAC  GACUUGAACAG  AA  ACCCACCCUAUGGG CUGUGCAAGGC CGAG CUCCCCU GGCAUU UCUUAUGUGU

>TXNRD2_galGal Gallus gallus (chicken) score: 31
UUGUAGGUCU UUUCUCA GGAUGCCAGCUG  AUGAU  GGCUUGUUUGUC  AA  ACCACACCAUG GUGCAGACAAGUC UGAG CAC UGCUGGG UCCCUUAUGU

>TXNRD2_taeGut Taeniopygia guttata (finch) score: 30
AUGUAGUCAG GCUUCUU AGGAUGCCAGCUG  AUGAG  GAUUUGUUUGUC  AA  ACCACACCAUG GUGCAAACAAGUC UGAG CUUU GCUGGGU CCCUCAUAUG

>TXNRD2_anoCar Anolis carolinensis (lizard) score: 29
cugaaaaaug cguaccu uGGAUGCCAGCGA  AUGAC  GGCUUGUGUACG  AA  ACCACAUGUUGG AGUAGACAAGUC UGAU GUUUUGCU GGGUCC UUUUUcagaa

>TXNRD2_xenTro Xenopus tropicalis (frog) score: 28
CUGACUGCAG GACGCCA UCUUAGUGCUAUU  GUGAC  GUCACAUCCCA  AA  GCCAGAUUUGG UGGGCUGUGAC UGAA GACC UGCGCAC UCAGUUUAUC

>TXNRD2_xenTro Xenopus tropicalis (frog) score: 33
uugagaauga cacauaa gggguaucagcua  augaa  ggcuuguguau  aa  acccacccuguggg cugggcagguc ugag caucucuga uucucug uuacguguaa

>TXNRD2_calMil Callorhinchus milii (elephantfish) AAVX01015557 position 193 after stop score: 30.15
caugaccaac acuuugc cguuua augac gagcuguuugu aa acccagcgacguggg agagacagccc ugau gacaa ucggcau cgagaucuaa

SELS: 21 SECIS insertion sequences

>SELS_homSap Homo sapiens (human) score 36.61
uaggacaguc ucuguga cagguugcguuga augau gucuuccuuauc aa uggugagcccacca gugaggauuac ugau gugga caguuga ugggguuugu

>SELS_panTro Pan troglodytes (chimp) score 36.61
uaggacaguc ucuguga cagguugcguuga augau gucuuccuuauc aa uggugagcccacca gugaggauuac ugau gugga caguuga ugggguuugu

>SELS_macMul Macaca mulatta (rhesus) score 36.61
uaggacaguc ucuguga cagguugcguuga augau gucuuccuuauc aa uggugagcccacca gugaggauuac ugau gugga caguuga ugggguuugu

>SELS_otoGar Otolemur garnettii (bushbaby) score 38.23
uaggacaguc ucuguga cagguugcguuga augau gucuuccuuau aa auggugagcccacca gugaggauuac ugau acaga caguuga ugggguuugu

>SELS_tupBel Tupaia belangeri (treeShrew) score 40.14
gagaacaguc ucuguga cagggugcgucga augau gucuuccuuau aa auggugagcccacca cugaggaguac ugau gcaga caguuga caggguuugu

>SELS_musMus Mus musculus (mouse) score 41.68
caggaugguc ucuguga cgggaugcguuga augau gucuuccuuau aa auggugaacccacca gugaggauuac ugau guu cacagu ugacgggguu

>SELS_ratNor Rattus norvegicus (rat) score 40.42
cagggugguc ucuguga caggaugcguuga augau gucuuccuuau aa auggugagcccacca gugaggauuac ugau gua cacagu ugaugggguu

>SELS_cavPor Cavia porcellus (guineaPig) score 40.42
aaggacaguc ucuguga cgagcugcguuga augau gucuuccuuau aa auggugagcccacca gugaggauuac ugau gcaga caguuga ugggguuuau

>SELS_canFam Canis familiaris (dog) score 39.26
uaggacaguc ucuguga cagguugcguuga augau gucuuccuugu aa acggugagcccacca gcgaggauuac ugau gcaga caguuga ugggguuguu

>SELS_felCat Felis catus (cat) score 41.01
uaggacaguc ucuguga cagguugcguuga augau gucuuccuugu aa auggugagcccacca gcgaggauuac ugau gcaga caguuga ugggguuguu

>SELS_equCab Equus caballus (horse) score 41.01
uaggacaguc ucuguga cagguugcguuga augau gucuuccuugu aa auggugagcccacca gcgaggauuac ugau gcaga caguuga uggguuguuu

>SELS_bosTau Bos taurus (cow) score 41.15
uaggacaguc ucuguga cagcuugcguuga augau gucuuccuugu aa auggugagcccacca gcaaggauuac ugau gcaga caguuga ugggguuguu

>SELS_eriEur Erinaceus europaeus (hedgehog) score 36.87
cucucuguga uggguug cguugg augau gucuuccuuguc aa uggugaacccacca gcgaggaucac ugau gcag acaguug augggguugu

>SELS_sorAra Sorex araneus (shrew) score 35.70
ugccgggccc gucucug ugauaggcgacga augac gucguccucgg aa auggugugccacca gcgaggaccac cgau gaagacacu ccugggc gccccccccc

>SELS_dasNov Dasypus novemcinctus (armadillo) score: 35.89
uagaacaguc ucuguga cagguugcguuga augau gucuuccuuau aa aauggugaacccacca gugaggauuac ugau aauaga caguuga ugggguuugu

>SELS_choHof Choloepus hoffmanni (sloth) score: 37
UAGaACAGUC UCUGUGA CgGGUUGCGUUGA AUGAc GUCUUCCUUAU aA AcGGUGAagCCACCA GUGAGGAUaAC UGAU aauaGA CAaUUGA UGGGGUcUGU

>SELS_loxAfr Loxodonta africana (elephant) score: 39 traces lacking coding
UGGAAUAGUC UCUGUGA CAGGGUGCGUUGA AUGAU GUCUUCCUUAU AA AUGGUGAACCCACCA GUGAGGAUUAC UGAU AAUAGA CAGUUGA UGGGGUUUGU

>SELS_echTel Echinops telfairi (tenrec) score 38.43
uagaacaguc ucuguga cagguugcguuga augaa gucuuccuuau aa auggugaacucacca gugaggauuac ugau aaaga caguuga ugagguuugu

>SELS_monDom Monodelphis domestica (opossum) score: 41 
uagaugAGUC UCUGUGA CAGGcUGCGcaGA AUGAU GUCUUCCUUAU aA AUGGUGAGCuCACCA GUGAGGAUUAC UGAU Gauagauag uuguugg uguuuuuuuc

>SELS_macEug Macropus eugenii (wallaby) trace score: 42
UAGAUGAGUC UCUGUGA CAGGCUGCGCAGA  AUGAU  GUCUUCCUUAU  AA  AUGGUGAACUCACCA GUGAGGAUUAC UGAU GAUAGA UAGUUGG UGGUGUUUUU

>SELS_triVul Trichosurus vulpecula mRNA score: 42
uagaugaguc ucugugg caggcugcgcaga augau gucuuccuuau aa auggugaacucacca gugaggauuac ugau gauaga uaguugg ugguguuuuu

>SELS_ornAna Ornithorhynchus anatinus (platypus) score: 33
ucaauaAGUC UCUGUGA CAGGcgGCaUUGA AUGAU GUCUUCCUUgU aA AUGGUGAaaCCCACCA GUGAGGAUUAC UGAU aua gacagg agaugguauu

>SELS_galGal Gallus gallus (chicken) score 35.60
cgggagaguc ucuguga caagcugcucugu augau guuuuccuuau aa augguaaacaaacca augaggauuac ugau gcua gacagca gauggggguu

>SELS_taeGut Taeniopygia guttata (finch) score: 38
CAGAAGAGCC UCUGUGA CAAGCCAGCUUGA  AUGAU  GUUUUCCUUAU  AA  AUGGUAAACAAACCA GUGAGGAUUAC UGAU GCU AGACAGG AGACAGGGGG

>SELS_xenTro Xenopus tropicalis (frog) score: 40 
AGGCCGGGGA ACUGCAA UCUGACACUCUGC  AUGAU  GUCCUCCUUAC  AA  AUGGCACAAUAGCCA AUGAGGAUGAC UGAU GUU GUUAGGU GGUAUGCACU

>SELS_calMil Callorhinchus milii (elephantfish) AAVX01138705 position 244 after stop COVE score: 33.09 
ugaagcaaga ugaaauu gacagcuauga  augac  gccauccuugu  aa  augguuccccaacca augaggauguc ugaa auuggacagg gauagug cgagauguau

SELT: 21 SECIS insertion sequences

>SELT_homSap Homo sapiens (human) score: 39.15
gaucauugca agagcag cgugacugacauu augaa ggccuguacug aa gacagcaagcugu uaguacagacc agau gcu uucuug gcaggcucgu

>SELT_panTro Pan troglodytes (chimp) score: 39.15
gaucauuuca agagcag cgugacugacauu augaa ggccuguacug aa gacagcaagcugu uaguacagacc agau gcu uucuug gcaggcucgu

>SELT_macMul Macaca mulatta (rhesus) score: 39.15
gaucauugca agagcag cgugacugacauu augaa ggccuguacug aa gacagcaagcugu uaguacagacc agau gcu uucuug gcaggcucgu

>SELT_otoGar Otolemur garnettii (bushbaby) score: 39.15
gauuuuugca agagcag cgugacugacagu augaa ggccuguacug aa gacagcaagcugu uaguacagacc agau gcu uucuug gcaggcucgu

>SELT_musMus Mus musculus (mouse) score: 39.15
ggauuuugca agagcag cgugacugacauu augaa ggccuguacug aa gacagcaagcugu uaguacagacc agau guuucuugg caggcuc guuguaccuc

>SELT_ratNor Rattus norvegicus (rat) score: 39.15
ggauuuugca agagcag cgugacugacauu augaa ggccuguacug aa gacagcaagcugu uaguacagacc agau guuucuugg caggcuc guuguaccuc

>SELT_cavPor Cavia porcellus (guineaPig) score: 39.15
aauuuuugca agagcag cgugacugacauu augaa ggccuguacug aa gacagcaagcugu uaguacagacc agau gcu uuuuug gcaggaucgu

>SELT_oryCun Oryctolagus cuniculus (rabbit) score: 39.15
ggauuuugca agagcag cgugacugacauu augaa ggccuguacug aa gacagcaagcugu uaguacagacc agau gcu uuuuug gcaggcucgu

>SELT_canFam Canis familiaris (dog) score: 39.15
auuuuuugca agagcag cgugacugacauu augaa ggccuguacug aa gacagcaagcugu uaguacagacc agau gcu uucuug gcaggcucgu

>SELT_felCat Felis catus (cat) score: 39.15
auuuuuugca agagcag cgugacugacauu augaa ggccuguacug aa gacagcaagcugu uaguacagacc agau gcu uucuug gcaggcucgu

>SELT_equCab Equus caballus (horse) score: 38.49
gacuuuugca agagcag cguggcugacagu augaa ggccuguacug aa gacagcaagcugu uaguacagacc cgau gcu uucuug gcaggcucgu

>SELT_bosTau Bos taurus (cow) score: 39.15
gauuuuugca agagcag cgugacugacauu augaa ggccuguacug aa gacagcaagcugu uaguacagacc agau gcu uucuug gcaggcucgu

>SELT_eriEur Erinaceus europaeus (hedgehog) score: 39.15
gauuuuugca agagcag cgugacugacauu augaa ggccuguacug aa gacagcaagcugu uaguacagacc agau gcu uucuug gcaggcucgu

>SELT_sorAra Sorex araneus (shrew) score: 35.80
ggauucucca agagcag cgcggcugcccuc augaa ggccugcacug aa gacagcagcugu uggugcaggcu ggau cuuccugg caggcuc guuguaccuc

>SELT_choHof Choloepus hoffmanni (sloth) score: 37
cauuuUUGCA AGAGCAG CaUGACUGACAUU AUGAA GGCCUGUACUG AA GgCAGCAAGCUGU UAGUACAGACu AGAU GCaUUUGG CAGGCUC aUuguaccuc

>SELT_loxAfr Loxodonta africana (elephant) score: 36 genomic 3'
gauuuuuuCA AGAGCAG CGUGACUGACAUU AUGAA GGCCUGUACUG AA GACAGCgAGCUGU UAGUACAGACC AGAU GCU UUuUUG GCAGGCgCGU

>SELT_echTel Echinops telfairi (tenrec) score: 42
UCUUUUGCAA GAGCAGC GAGACUGACCUC  AUGAA  GGCCUGUACUG  AA  GACAGCCCUGCUGU UAGUACAGGCC AGAU GCUUCUCCUG GCAGGCUC GUUUGUACCU

>SELT_monDom Monodelphis domestica (opossum) score: 37 also segmental pseudogene
auuuUUGCgA GAGCAGC GUGguuggcacca AUGAA GGCCUGUACUG AA GACAGCAAGCUGU UAGUACAGACC AGAU acuu acuuugc agccucguug

>SELT_macEug Macropus eugenii mRNA score: 38
auuuuugcga gagcagc gugguuggcacca augaa ggccuguacug aa gacagcaugcugu uaguacagacc agau gcu uuauuu gcagccucgu

>SELT_ornAna Ornithorhynchus anatinus (platypus) score: 36
aucuuucuaa gggcaac gugauugaaaccU AUGAA GGCCUGUACUG AA GgCAGCAAaCUGU UAGUACAGACC AGAU Guuccu uugcagu cucguuguac

>SELT_galGal Gallus gallus (chicken) score: 38.05
gugauuucca aggccgc gugucucggacca augaa ggccuguacug aa gacagcuugcugu ugguacagacu ggau gcuucucuu gcaguc acguugugcc

>SELT_taeGut Taeniopygia guttata (finch) score: 40
GUGGUUCCUG GGCCGCG UGGUGCAGACCC AUGAA GGCCUGCACUG AA GACAGCCGCUGU UGGUGCAGGCU GGAU GCCUCUCU UGCAGCC ACGUUGUGCC

>SELT_anoCar Anolis carolinensis (lizard) score: 34
acaguuuuga aaggcaa caugaacgaaaua AUGAA GGuCUGUACUG AA GACAGCAuGCUGU Uggugcagacu ggau acuucuc cucgccuu cauguuguug

>SELT_xenTro Xenopus tropicalis (frog) score: 33
UUUGCAAUGG UGCCAAC GGGCCUGGUAUUC  AUGAA  GGCUUGCACUG  AA  GACACUUGCUGU UAGUGUAGGCU GGAG GCUUC UCUGCCG UCUCGUUGCG


>SELT_danRer Danio rerio (zebrafish) score: 34.86
ccggucagcg ggacugu ggacuguggcaua augaa ggccugcgcugc aa acagcacacug uuggcacaggcu ggau gcu cagccac cacacacacu

>SELT_tetNig Tetraodon nigroviridis (pufferfish) score: 33.32
ggugggucuc ccugugg gcugugagguu augaa ggucugugcug aa ggcaggacgacugc uagcucagacu ggau gucccca ucacug uucaccgugc

SELO: 9 SECIS insertion sequences

>SELO_homSap Homo sapiens (human) score: 25.77
cugcccuggc ccaugca cacccgucuuucc augau ggcagagacau cc agucaggaccuga cccgucucuguc ugag gccggcuc agcagug cagccugguc

>SELO_panTro Pan troglodytes (chimp) score: 25.77
cugcccuggc ccaugca cacccgucuuucc augau ggcagagacau cc agucaggaccuga cccgucucuguc ugag gccggcuc agcagug cagcuugguc

>SELO_macMul Macaca mulatta (rhesus) score: 25.77
cugccugggc ccaugca caccugucuuucc augau ggcagagacau cc agucaggaccuga cccgucucuguc ugag gccagcuc agcagug cagccugguc

>SELO_loxAfr Loxodonta africana (elephant) score: 25 T2 genomic 3'
CTGCCGTGTCCTGAGACACTGTCTCTC CATGGCGGCAGAGACGTCCAGTCAGGCCTGACCCGTCTCTGTCTGAT GTCGACTCTGCAGTGTGCC

>SELO_proCap  Procavia capensis (hyrax) score: 25
CTGCTGTGTCTCGAGACCCCGTCTCTC CATGGCGGCAGAGACGCCCAGTCAGGCCTGACCTGTCTCTGCCCGAT GCTGACCTGGCAGTGTGCC

>SELO_monDom Monodelphis domestica (opossum) score: 24.43
gucuggggcc uccccga uggcugcuucucc augaa ggcagagaugu cc agucggcuccga cccgucucuguc cgac gcugac ucggca gcccgagcuc

>SELO_macEug Macropus eugenii (wallaby) trace score: 27
AGCCCCCCAA AUCGCUG UUUUUCC  AUGAA  GGCAAAGACAU  CC  AGUCAGUCCUGAC CUGUCUCUGUC UGAU GCUGACU CAGCAG CCUAACCCUA

>SELO_ornAna Ornithorhynchus anatinus (platypus) score: 26
cggccUCCAA GCACCCG UUUUUUU  AUGAA  GACAAAAACCUC  AA  GUCAGGCCGCUGA UCCGUUUUUGUC CGAC GGCGAGUCAA CAGUGC CGCUUCGGCC

>SELO_galGal Gallus gallus (chicken) score: 26
uuugaacaUC CAAAUGG AGUUGUUAC  GUGAA  GACAAAAGUAUC  AA  GUCAGGAAUCUG AUCUGUUUUUGuc ugau gucuuaa cuaauag uacuucuaac

>SELO_taeGut Taeniopygia guttata (finch) score: 34
UUCAGUCAUC CAAAUGG AGUUGUUGUUAC  AUGAA  GACAAAAACAUC  AA  GUCAGGAAUCUGA UCUGUUUUUGUC UGAU GUCUUAA CUAAUAG UACUUCUAAU

>SELO_anoCar Anolis carolinensis (lizard) score: 26
AUGUCCAAGC AAAGUCU GUGUUU  UUGAA  GACAAAAAUAG  AA  AACCAGCUUUUGGC UAUAUUUUUGUC UGAA AAUG AAUUAAU AGUACUUCUG

>SELO_danRer Danio rerio (zebra fish) score: 17.80
UGUAAGUGAA AUGUGAC UGGUUUUUA  AUGAU  GACUUUGACC  AG  CAGUCUUUGCAUGACA GGUCUCAGUC GGAA AGACAGAA GUUAAG CCUCUCUAUG

>SELO_takRub Takifugu rubripes (fugu) score: 20.04
ccugcuugcc ccgaguu cuaccugcgaaua augac gacucagacaa ca agucugccagugac cugucugacuc ugaa cugugu ggugucg ccucagcaaa

SELV: 10 SECIS insertion sequences

>SELV_homSap Homo sapiens (human) score: 34.00
uuucucuccc aucuuag gagucucagcugg augau gagaagggcug aa auguugccaagu cagguccuuuu cugau ggug gcugggg cuggggugag

>SELV_panTro Pan troglodytes (chimp) score: 34.00
uuucucuccc aucuuag gagucucagcggg augau gagaagggcug aa auguugccaagu cagguccuuuu cugau ggug gcugggg cuggggugag

>SELV_otoGar Otolemur garnettii (bushbaby) score: 27.28
cuucucuccc aucucag gagccucgguagg augac gagaagggcug aa auauugccaugu cagguccuuuu cugau ggug gcuggga cugggguacg

>SELV_musMus Mus musculus (mouse) score: 33.37
cucucucccc aucucag gagccucagcagg augau gagaagggcug aa augcugccaaac cagguccuuuu cugau ggug gcugggg cuuggguggg

>SELV_ratNor Rattus norvegicus (rat) score: 33.37
uucucucccu gucucag gaaccucagcggg augau gagaagggcug aa augcugccaaac cagguccuuuu cugau ggug gcuggggc uugguuaggg

>SELV_cavPor Cavia porcellus (guineaPig) score: 34.34
uuuucucccc auguuag gagcugcagcagg augau gagaagggcug aa auguuguugagu cagguccuuuu cugau ggugg cugggcu gaguggagcu

>SELV_equCab Equus caballus (horse) score: 32.67
uucucucucc aucucag gagccucggugag augac gagaagggcug aa auguugccaagu cagguccuuuu cugau ggcg gcugggg cugagguggg

>SELV_sorAra Sorex araneus (shrew) score: 26.16 
cuucucuccc caucuca ggaaccucagaag augaa gggaagggcug aa auguugg cagguccuuuu cugac agu ggcugug gcuaugaugg

>SELV_dasNov Dasypus novemcinctus (armadillo) score: 22 T2
CTTTCCCCATCTCAGGAGCCTCAGCAG GATGGCGAGAAGGGCTGAAATGTTGCAGTCAGGTCCTTTTCTGAT GGTGGCTGGGGCTAGGGTGGG 

>SELV_loxAfr Loxodonta africana (elephant) score: 34.00
uucucucccc aucucag gagccucagcaag augau gagaagggcug aa auguugccaagu cagguccuuuu cugau ggug gcugggg cugggguggg

>SELV_echTel Echinops telfairi (tenrec) score: 26.31
uucucucucc accccag gagccgcagcaag augac gagaagggcug aa augucgu caggcccuuuu cugag ggug gcugggg cuaggcucgg

SELH: 18 SECIS insertion sequences

>SELH_homSap Homo sapiens (human) score: 23.94
UUUGUGUCCC UGGUGAU GUUGGAACAUUA AUGAU GGAACAUGGCC AA ACUUC AGUCAUGAUCC UGAA GCC AUGGUU UCUUCCCUGC

>SELH_panTro Pan troglodytes (chimp) score: 23.94 
uuuguguccc uggugau guuggaacauua augau ggaacauggcc aa acuuc agucaugaucc ugaa gcc augguu ucuucccugc

>SELH_macMul Macaca mulatta (rhesus) score: 26.97 
cuuugugucc cugguga ugcuggaacauua augau ggaacauggcc aa acuuc agucaugugcc ugaa gccaugg uuucua ccccgccaga

>SELH_otoGar Otolemur garnettii (bushbaby) score: 22.59 
cuuucugugc uggugau guuggagcaugu augac gggacauggcc aa acuua agucaugugcc ugaa gcu acaguuu cuuccccucc

>SELH_tupBel Tupaia belangeri (treeShrew) score: 26.55 
gcuuuuccug gugaugu ugaagggacauuu augau gggacauggcc aa acuuc agucaugugcc ugaa gcc aagguuu cuuccccucc

>SELH_musMus Mus musculus (mouse) score: 24.55 
cuuucagucc cuggaga uguugaagcauuu augau ggugcauggcc aa acuua agcuaugcacc ugaa gccauag uuucuu ccucaccaga

>SELH_ratNor Rattus norvegicus (rat) score: 23.97
cuuucagucc cuggaga uguugaagcauuu augau ggugcauggcc aa acuua agcuauguacc ugaa gccauag uuucuu ccucaccaga

>SELH_cavPor Cavia porcellus (guineaPig) score: 19.25 
uuucuguucc ugguccu guuggggcgucu gugau gggacauggc ca aacuaaag ccauggccc ugaa gcc augguc ucuagcaucc

>SELH_canFam Canis familiaris (dog) score: 23.64 
agcauauccc uggugau guuggagcauuu augac ggaacauggcc aa acuuc agucauguacc ugaa gcc augguu ucuucccucc

>SELH_felCat Felis catus (cat) score: 24.80 
cuucucuccc uggugac guuuggagcauuu augac gggacauggcc aa auuuc agucaugugcc ugaa gcccug guuucu uccccuccag

>SELH_equCab Equus caballus (horse) score: 25.73
ccuucguccc ugguguu guuggagcauuu augac gguacauggcc aa acauc agucaugugcc ugaa gcu gugguuu cuuccccucc

>SELH_bosTau Bos taurus (cow) score: 28.39
ccucuguccc uggugau guuggagcauuu augac gggacauggcc aa acuuc agucauguccc ugaa gcu gugguu uccuccccuc

>SELH_sorAra Sorex araneus (shrew) score: 24.10
cuuucuguuc uggugau guuggagcauug augau ggaacaugacc aa acguc agucaugugcc ugaa gccaa guuucu uucucuccag

>SELH_dasNov Dasypus novemcinctus (armadillo) score: 25.97
cuucuauccu uggugau guuggagcauuu augau gggacauggcc aa acuuc agucauguacc ugaa gcca guuucu cccccuccag

>SELH_choHof Choloepus hoffmanni (sloth) score: 22
UAUCCUUGGG GAUGUUG GAGCAUUU  AUGAU  GGGACACGGCC  AA  AUUUCA GUCAUGUACC UGAA GCC ACUGUU UCUUCCCCUC

>SELH_loxAfr Loxodonta africana (elephant) score: 25.83 
cuucuguccc uggugau guuggagcauuu augac ggaacauggcc aa accuc agucaugugcc ugaa gcc acgguuu cuuccccucc

>SELH_echTel Echinops telfairi (tenrec) score: 26.97
agucccgucc cugguga uguuggagcauuu augau ggaacauggcc aa acuuc agucaugugcc ugaa gcccguc uccuca cuuccagaaa

>SELH_monDom Monodelphis domestica (opossum) score: 26.74 
ugccuguccc cagugag uuuggagcaucc augau ggaaccugacc aa aucuccca gucacguccc ugaa gcuuggg cuccuu cuccugggaa

>SELH_macEug Macropus eugenii (wallaby) trace score: 29
UGCUUGUCCC CAGUGAG UUUGGAGCUUCU  AUGAU  GGAACAUGACC  AA  AUCUUCCA GUCACGUCCC UGAA GCUACAG CUCCUU CCACUGGGAA

>SELH_anoCar Anolis carolinensis (lizard) score: 27.10 
auacauucuc ugugagu uggagcauuc augau gggauaugauc aa guggagcaaaucc agucacaucuc ugaa gcu guugcc cuccuccaca

SEPP2: 5 SECIS sequences

>SEPP2_monDom Monodelphis domestica (opossum) score: 30
ACGUGCCGCU GCCCCUC CCUCCCUCCAAGA AUGAC GCCCACAGUGA AA CCCAGAGAACUGG UCCCUGUGGGC UGAU GCCC CAGAGGG GAGGAGAGGC

>SEPP2_macEug Macropus eugenii (wallaby) score: 26.38
CUUGCCCAUU GCCCUUC CCUCCCUCAAUUA AUGAU GCCCACAGUGA AA CCCGGGGAACCGG CCAUGGUGGGC UGAU GCCAU GGAGAAG AGGAAUGAGG

>SEPP2a_ornAna Ornithorhynchus anatinus (platypus) score: 34.28
UCCCUCGACU CCCGCUC CCGCCUCGCACUC AUGAC GUCCACGGUGUC AA CCGGCCCGCCG GGCACCGUGGAC UGAC GCC GGUCGAG GCGGAGGGGU

>SEPP2b_ornAna Ornithorhynchus anatinus (platypus) score: 22.82
GGAAUCAGGA ACCCAGU AAC AUGAG GUCAUCUUCGG AA GCCUGUGCCUAGAGGA CCAAGAUAAU GGAA AAAGUGACGG ACAAGGGU GUGUAGCUGG

>SEPP2_tetNig Tetraodon nigroviridis (pufferfish) score: 17
GCUGGACCCA GGCUGCU GGUGGUCCCGUUG AUGAC GUCUGCGCUGGU AA ACCUGCCUGCAGG AGCCUGUGGAC CGAC GUG UGUGGAC CCACCGGCAG

SELL: 17 SECIS sequences

>SELL_danRer Danio rerio (zebrafish) Score2: 23 no score1
gctccccctgAGGTTGCATGG ATGAA GATTTGACTCG AA TTCTTATATTTACGAAGAGTCTTTTC TGAT GGGAATTTACACCCTCAG

SELI: 17 SECIS sequences

>SELI_homSap Homo sapiens (human) score: 21.61
UUUCACUGAA UGAAGUU UGUGCUUGA AUGAA GAGUGUAUCUUA AA CCCCCUUUUUUUGGA CAGGCUGCACUU GGAU AAAAUA GGCACCA CUGUGUUGAU

>SELI_panTro Pan troglodytes (chimp) score: 21.61
uuucacugaa ugaaguu ugugcuuga augaa gaguguaucuua aa cccccuuuuuuugga caggcugcacuu ggau aaaaua ggcacca cuguguugau

>SELI_macMul Macaca mulatta (rhesus) score: 21.25
uuucacugaa ugaaguu ugugcuuga augaa gaguguaucuua aa ccuccuuuuuuugga caggcugcacuu ggau aacaua ggcacca cuguguugau

>SELI_otoGar Otolemur garnettii (bushbaby) score: 21.25
uuucacuaag ugaaguu ugugcuuga augaa gaguguaucuu aa acccuuuuuuuuggac agguugcacuu ggau aaaaua ggcacca uuguguugau

>SELI_musMus Mus musculus (mouse) score: 24.62
uuccacugaa ugaaguu ugugcuuaa augaa gagugugucuu aa acccuuuuuuuuggac agguugcacuu ggau aaaaua ggcacca cuguguugau

>SELI_ratNor Rattus norvegicus (rat) score: 24.62
uuccacugaa ugaaguu ugugcuuaa augaa gagugugucuu aa acccuuuuuuuuggac agguugcacuu ggau aacaua ggcaccg cuguguugau

>SELI_cavPor Cavia porcellus (guineaPig) score: 17.42
uuccagugaa ugaaguu ugugcuuga augaa gaguguaucuua aa cccuuuuuuuuuugga cagguugcacuu ggau aaaaua ggcacca cuguguugau

>SELI_oryCun Oryctolagus cuniculus (rabbit) score: 19.47
ucuacugaau gaaguuu gugcuuga augaa gaguguaucuua aa cccuuuuuuuuugga cagguugcacuu ggau aaaau aggcac cacuguugau

>SELI_eriEur Erinaceus europaeus (hedgehog) score: 14.43
cacggaauga aguaugu gcuuga augaa gaguguaucuu aa acccuuuuuuuuuuuugga cagguugcacuu ggau aua auaggc accacucugu

>SELI_canFam Canis familiaris (dog) score: 14.04
uuccacugaa ugaaguu ugugcucga augaa gaguguaucuua aa cccuuuuuuuuuugga uggauugcacuu ggau aaaaua ggcacca cuguguugau

>SELI_equCab Equus caballus (horse) score: 19.57
uuucacugag ugaaguu ugugcucga augaa gaguguauucuu aa acccuuguuuuugga uggauugcacuu ggau aaaaua agcacca cuguguugau

>SELI_dasNov Dasypus novemcinctus (armadillo) score: 18
uauUUUCuAC UGAAUuA AGUUUGUGCUUGA AUGAA GAGUGUAUCUU AA ACCCuuugUUUUUUUGGA CAGGuUGCACUU GGAU AAAA UAGGCA CCACUaUGUU

>SELI_choHof Choloepus hoffmanni (sloth) score: 19
uuccaccGAA UGAAGUU UGUGCUUGA AUGAA GAGUGUAUCUUA AA CCCuuUUUUUUUGGA CAGGuUGCACUU GGAU AAAAUA GGCACCg CUaUGUUGAU

>SELI_loxAfr Loxodonta africana (elephant) score: 26 genomic 3'
UUcCACUGAA UGAAGUU UGUGCUUGA AUGAA GAGUGUAUCUU AA ACCCuUUUUUUUGGA CAGGuUGCACUU GGAU AAAgUA GGCACCA CUGUGUUGAU

>SELI_monDom Monodelphis domestica (opossum) score: 26 
UUUCuACUGA AUGcAaU UUGUGCUUGA AUGAA GAGUGUgUCUU AA AuccuuuauaUGGAC AGGCUGCACUU GGAg aga auaagca caaccauguu

>SELI_macEug Macropus eugenii (wallaby) trace score: 26
UUUCUACUGA AUGCAGU UUGUGCUUGA  AUGAA  GAGUGUGUCUU  AA  ACCCUUUUUAUGGAC AGGCUGCACUU GGAG AGA AUAAGCA CAACCAUGUU

>SELI_ornAna Ornithorhynchus anatinus (platypus) score: 19
ucccagUGAA UGAAGcU UGUGCUUGA AUGAA GAGUGcAUCUU AA ACCCaUUUUUUUugga aaaGCUGCACUU GGAg agaaag ggcacg acuguguuua

>SELI_galGal Gallus gallus (chicken) score: 22
auuuAAUGAA GaUcUGU GCUUGA AUGAA GAGUGUAgCUU AA ACCCaggcucUGGAa AGGCUGCAucc ggaa gcaa acaagc acagcagauu

>SELI_taeGut Taeniopygia guttata (finch) score: 20
UCAAAUGAAA ACCCGUG CUUGA  AUGAA  GAGUGUAGCUU  AA  AGCCAGGCUCUGGAA AGGCUGCAUCC GGAA GAGAACAAG CACAGAU CCUGCAGGUG

>SELI_anoCar Anolis carolinensis (lizard) score: 22.02
uccccuuugu guguguc cuuugugcgugu augaa gagugcggccuc aa cccaggcgucuugga agggccgcaccc ggaa gaa acggagc acagcaaaga

>SELI_xenTro Xenopus tropicalis (frog) score: 17
aucaauagaa uagcagc ggccgugcuuga  augaa  gggcguaucua  aa  gccugugguuuggac aggguacacuc ggag gca gcaagcg cagccgcugc

SELK: 19 SECIS sequences

>SELK_homSap Homo sapiens (human) score: 34.53
acaaggacug cucugug uccucacagauga augag gucaugcuggg aa uucccucugcaggga acuggccugac ugac augcaguuc cauaaa ugcagauguu

>SELK_panTro Pan troglodytes (chimp) score: 34.53 
acaaggacug cucugug uccucacagauga augag gucaugcuggg aa uucccucugcaggga acuggccugac ugac augcaguuc cauaaa ugcagauguu

>SELK_macMul Macaca mulatta (rhesus) score: 36.14 
acaaggacug cucugug uccucacagauga augag gucaugcuagg aa uucccucuacaggga acuggccugac ugac augcaguuc cauaaa ugcagauguu

>SELK_otoGar Otolemur garnettii (bushbaby) score: 31.99
caaggauugc ucugugu cuucacagauga augag gucaggcuggg aa uucucucuucaggga acuggccugac ugac augcagu ucuauaa acgcacuuuu

>SELK_tupBel Tupaia belangeri (treeShrew) score: 36.65
acaaggauug cucugug uccccacagauga augag guuaugccggg aa uucccuccacaggga ucuggccugac ugau acgcaguuc uauaaa ugcacauguu

>SELK_musMus Mus musculus (mouse) score: 31.73
acaaggauug cucugug uccccacagauga augag gucaugcuggg aa uucccucugcagga ucuagccugac ugau acgcaguuc uauaaa uguacauguu

>SELK_ratNor Rattus norvegicus (rat) score: 33.02
acaaggacug cucugug uccucacagaaga augag gucaugcuggg aa cucccucugcagga ucuggccugac ugau gugcaguuc uauaaa uguacaugug

>SELK_cavPor Cavia porcellus (guineaPig) score: 33.72
cucuguguuc ucacaga uaa augag gucacgccagg aa uucucucagcaggga ucuggcuugac ugau acgcagu ucucua aaugcauaug

>SELK_oryCun Oryctolagus cuniculus (rabbit) score: 38.80 
accaggauug cucugug uccccacagauga augau gucaggcuggg aa uucccuccacaggga ucuggccugau ugag augcaguuc uauaaa ugcguauguu

>SELK_sorAra Sorex araneus (shrew) score: 40.91
auaaggacug uucugug uccacacagauga augag gucaugcuggg aa uucccucuacgggga ucuggcaugac ugau augcag uucgaua aaugcacaug

>SELK_eriEur Erinaceus europaeus (hedgehog) score: 37.30
acaaggauug cucugug uucucacagguga augag guuaugcuggg aa uucccuccaugggga ucuggcaugac ugau augcaguuc uauaaa ugcacauguu

>SELK_canFam Canis familiaris (dog) score: 36.30 
acaaggauug cucugug ccuucacagacgg augag guugugcuagg aa uucccuccccaggga ucuggcaugac ugac augcaguuc uauaaa ugcacauguu

>SELK_felCat Felis catus (cat) score: 37.35
acgagaauug cucugug uccucacagacag augag gucgugcuggg aa uucccuccccaggga ucuggcaugac ugac augcaguuc uauaaa ugcacauguu

>SELK_bosTau Bos taurus (cow) score: 39.16 
cucugugucc ucacaga cga augag gucaugcuggg aa uucccuccgcaggga ucuggcaugac ugac augcagu ucuaua aaugcacguu

>SELK_dasNov Dasypus novemcinctus (armadillo) score: 25 T2
ACAAGGAtTGCTCTGTGTCCTCACA GATGAATGAGGTCgTGtTGGGAATT CCtTCTGCAGGGAtCTGGCaTG TGACTGcCcTGCAGTTCtATAAAT

>SELK_choHof Choloepus hoffmanni (sloth) score: 34
ACAAGGAuUG CUCUGUG UCCcCAgAGAUGA AUGAG GUugUGCUGGG AA UUCCCcCUGCAGGGA uCUGGCaUGAC UGAC AUGCAGUUC uAUAAA UGCAcaaguu

>SELK_loxAfr Loxodonta africana (elephant) score: 35 genomic 3'
acaaaGACUG CUCUGUG UCCcCACAGAcGg AUGAG GcugUGCUGGG AA UUCCCUCUGCAGGGA uCUGGCaUGgC UGAC AUGCAGUUC CAUAAA UGCAcAUGUU

>SELK_echTel Echinops telfairi (tenrec) score: 33
ACAAGAAUUG CUCUGUA UCCCCACAGACGA  AUGAG  GUCGUGCUGGG  AA  UUCCCUCUGCAGGGA UCUGGCGUGGC UGAC AUGCAGUUC UAUAAA UGCACAUUUU

>SELK_monDom Monodelphis domestica (opossum) score: 21.75
aagaauugcu cugucua cacagauua augau guugugcuggg aa cucccaucuuacagga uccaguguaac ugau ugcaa uuguaua aaugcacaug

>SELK_macEug Macropus eugenii (wallaby) trace score: 23
AAAAGGAUUG CUCUGUA UCUCCACAGAUUA  AUGAU  GUUGUGCUGGG  AA  CUCCCUUCUGCCGGGA UCCGGUGUAAC UGAU UGCAGU UGUAUA AAUGCACAUG

>SELK_ornAna Ornithorhynchus anatinus (platypus) score: 33.68
aauaauugug cugugaa caagcagauua augau guuuugcuggg aa uuccuucaggga uccaguauaac ugau aaagc aauuaua uaaaggcaca

>SELK_galGal Gallus gallus (chicken) score: 30.90
ugagaacugu ucugcaa uauaagcagauga augaa guuguacuggg aa cuccuucaagga uccaguguaac ugaa gugcagug uuauuaa auacauguuu

>SELK_taeGut Taeniopygia guttata (finch) score: 33
UGGAAACUGU UCUGUGA UAGAAGCAGAUUA  AUGAA  GUUGUACUGGG  AA  CUCCUUCCUCAAGGA UCCAGUGUAAC UGAA CCACAGU UUCAUUA AAUACAUGUU

>SELK_xenTro Xenopus tropicalis (frog) score: 19 T2
ATGAAATGCTCTG CAGCAATGCGGATACATGATGTTGTGCTGGGAGCTCCCGACCAGGA TCCAGTAGCGACTGATCAGCATTTATTTATAT 

GPX3: 15 SECIS sequences

>GPX3_homSap Homo sapiens (human) score: 27.80
CACGGACCCCA UGGCAGG GGUGGCGUCUUC AUGAG GGAGGGGCCCA AA GCCCUUGUGGGC GGACCUCCCC UGAG CCUG UCUGAG GGGCCAGCCCT

>GPX3_panTro Pan troglodytes (chimp) score: 27.80 
cacguacccc augucgg ggguggugucuuc augag ggaggggccca aa gcccuugugggc ggaccucccc ugag ccugu cugagg ggccagcccu

>GPX3_macMul Macaca mulatta (rhesus) score: 27.80 
cacguacccc augucag ggguggcgucuuc augag ggaggggccca aa gcccuugugggc ggaccucccc ugag ccugu cugagg ggccagcucu

>GPX3_tupBel Tupaia belangeri (treeShrew) score: 29.38 
ccacaucccu gugucag ggguggcaucucc augag ggaggggcccg aa gcccuuguggg cggaccucccc ugag ccugu cugagg ggccggcccu

>GPX3_musMus Mus musculus (mouse) score: 33.37 
cguguacccc aggucag ggguggugucucu augaa ggaggggcccg aa gcccuuguggg cgggccucccc ugag cccgu cuguggu gccagcccuu

>GPX3_ratNor Rattus norvegicus (rat) score: 33.37 
caugugcucc aagucag ggguggugucucc augaa ggaggggcccg aa gcccuuguggg cgggccucccc ugag cccgu cuguggu gccagcccuu

>GPX3_canFam Canis familiaris (dog) score: 29.96
cauguucccc gugucag gaauggcaucucc augaa ggaggggccc ga agcccucaugggc ggaccucccc ugag ccugu cugaag ggccggcccu

>GPX3_felCat Felis catus (cat) score: 30.08 
ccacguccc gugucag ggauggcgucucc augaa ggaggggccc ga agcccuugugggc ggaccucccc ugag ccugu cugaag ggccagcccu

>GPX3_equCab Equus caballus (horse) score: 26.20 
uacauucccc augucag ggguggcaucucc augau ggaggggcccg aa gcccugguggg cggaccucccc agag ccugu cugaag ggccagcccu

>GPX3_bosTau Bos taurus (cow) score: 30.87 
cacguuccccg ugucagg gggcggcaucgcc augaa ggaggggcccg aa gcccgcguggg cgggccucccu ugag ccu gucugag gggccagccuu

>GPX3_loxAfr Loxodonta africana (elephant) score: 16.32 
cuacgucccc gugucaa gagcggcaucucc augau gguggggcccg aa gccccugugg cggaccucccc agag ccugucc caugggc cagcccuu

>GPX3_echTel Echinops telfairi (tenrec) score: 12.78 
ggcugugucc cgugcag agggagcaucucc augag ggugaggcccg aa gcccccgugg cggaccucgac ccgag ucug cucugg gccugccuuc

>GPX3_monDom Monodelphis domestica (opossum) score: 22.94
ugaacauaag ggauggc aucucu augau ggugggaucca aa gccucuucaggg cggguuccauc agag ccugcaaaa gguguc aggacccuua

>GPX3_macEug Macropus eugenii (wallaby) trace score: 26
UGUCCUAAAC UAAGGGA CAACAUCUCU  AUGAU  GGUGGGAUCCA  AA  GCCUCUCCAAGG CGGAUCCCAUC AGAG CCUGCAAAGG UGUCAUG ACCCUUAGUG

>GPX3_ornAna Ornithorhynchus anatinus (platypus) score: 31.33
ugucccagaa uggggag guggcaucauc augac agcggggucug aa agccccuccugga uggaccccgcc cgaa ccug cucggcg guggcaugac

>GPX3_anoCar Anolis carolinensis (lizard) score: 28.20 
GAGAUUUUGG GCCAAGG AAGUUGCAUCACU AUGAG GGUUAGGUCUG AA AGCUCCCAAAAAGAG CGGACCUAGCC UGAG GCUGCAAA GCUCUGGU GUAGCCCUUU

>GPX3_galGal Gallus gallus (chicken) score: 30.65
GCCCUGGGGA GCAGAGG AUGACAUCUCC AUGAA GGCCUGGCCUG AA AGCCCCCACCAUGGGG UGGGCUCGGCC CGAU CCCG CCCAGGC GCGGUGCAGC 

GPX6: 10 SECIS sequences (most species have selenocysteine)

>GPX6_homSap Homo sapiens (human) score: 18.10
cccaccucac augaagg gaagggcaucucc augau gguggauccc aa aaccccucuggguc gcacccugcc agag ccu uccuug gugccugucc

>GPX6_panTro Pan troglodytes (chimp) score: 23.45
cccaccucac augaagg gaggggcaucucc augac gguggguccc aa aaccucucgggguc ggacccugcc agag ccu uccuug gugccugucc

>GPX6_macMul Macaca mulatta (rhesus) score: 21.81 
accucauuca cagaagg gaggggcaucuuu augau ggugggucuc aa aaccucucuggguc agacccuacc agag ccu uccuug gugccugucc

>GPX6_cavPor Cavia porcellus (guineaPig) score: 19.91
AGAAGCCUCC CUAGAAG GAAGGGUGUCUCC AUGAU GGUGGGUCCC AA AAGCCCUGGAUC GGACCCUACC AGAA CCU UCCCUGG UGCCUGUCCU

>GPX6_canFam Canis familiaris (dog) score: 24.33
CCUGGCCUCA UAUGAAA GGAGGGCAUCUCC AUGAU GGUGGGUUCC CA AGCCCCUGCGGUC GGACCCUACC AGAG CCU UCUUGG GUGCCUGUCC

>GPX6_equCab Equus caballus (horse) score: 25.00
uucaucucac augagcu gaggggcaucucc augau gguggguccc aa agccccugugggc aggacccaac cagaa cucug ugccugu cccuuagugc

>GPX6_bosTau Bos taurus (cow) score: 23.33 
cucacuucac augagga aaagggcaucucc augau gguggguccc aa agccucucuggguc ggaccccacc agag ccu uccuugg ugccuguccc

>GPX6_eriEur Erinaceus europaeus (hedgehog) score: 24.33
ccuggccuca uaugaaa ggagggcaucucc augau gguggguucc ca agccccugcgguc ggacccuacc agag ccu uccuugg ugucuguccu

>GPX6_sorAra Sorex araneus (shrew) score: 22.95
uuucauauga aaggagg gggcaucucc augau ggugggucuc aa agccccucuggguc ggacccuacc agag cccugcugg guguccu gucccuuugu

>GPX6_dasNov Dasypus novemcinctus (armadillo) score: 19.82 
cucaccuuac augaagg gagggacauaucc augau gguggguccu aa agcccuucuggguc agacccuacc agaa ccu ucucug gugccugucc

>GPX6_choHof Choloepus hoffmanni (sloth) score: 23
cucaguUCAC AUGAAGG GAgGGGCAUCUCC AUGAU GGUGGgUCuCA AA gCCCCUCUGGGU uGgACCCUaCC AGAG CCUU CCcUGGU GCCUGUCCcu

>GPX6_loxAfr Loxodonta africana (elephant) score: 19.28 
cucaccucac augaaug gaggggcauaucc augau gguggguccc aa agccucucuagguc ggacccuauc agaa ucuucccugg ugccugu cccuuagugc

>GPX6_echTel Echinops telfairi (tenrec) score: 31.33 
ugugucccag aaugggg agguggcaucauc augac agcggggucu ga aagccccuccuggau ggaccccgcc cgaa ccu ucccug gugccugucc

GPX1: 17 SECIS insertion sequences

>GPX1_homSap Homo sapiens (human) score: 20.45
UGCUGUCUCG GGGGGGU UUUCAUCU AUGAG GGUGUUUCCUCU AA ACCUACGA GGGAGGAACACC UGAU CUUACAGAAA AUACCAC CUCGAGAUGG

>GPX1_panTro Pan troglodytes (chimp) score: 20.45 
gugcugcucu guggggg gguuuucaucu augag gguguuuccucu aa accuacga gggaggaacacc ugau cuuacagaaa auacccc cucgagaugg

>GPX1_macMul Macaca mulatta (rhesus) score: 26.45 
gcagcgcugc ucucugg gggguuuucaucu augag gguguuuccucu aa accuaca aggaggaacacc ugau aau acagaa aauacccccu

>GPX1_otoGar Otolemur garnettii (bushbaby) score: 25.30 
auagcgcugc ucucugg ggggguuucauuc augau aguguuaccucu aa acuugcau gggggaacacc ugau gcc ccagaaa auccccugag

>GPX1_tupBel Tupaia belangeri (treeShrew) score: 21.14
cagcgcugcg ucugggg gguuucaucc augac ggugucuccucu aa accccga aggaggaacgcc ugau guccggaaaa cccccca ggugggcgcc

>GPX1_musMus Mus musculus (mouse) score: 29.78 
ggcugcacuc ugggggg cgguucuucc augau gguguuuccucu aa auuugca cggagaaacacc ugau uuccaggaa aaucccc ucagaugggc

>GPX1_ratNor Rattus norvegicus (rat) score: 25.72
ggcugcccuc cgggggg agguuuuucc augac gguguuuccucu aa auuuaca uggagaaacacc ugau uuccagaaa aaucccc ucagaugggc

>GPX1_cavPor Cavia porcellus (guineaPig) score: 15.34 
uugcccagau gcucucc ugaggguucuucc augaa gguguuuccucuc aa ccugua uagaggaacauc cgau uccca ggaauu ucccagagag

>GPX1_oryCun Oryctolagus cuniculus (rabbit) score: 24.38 
guggccugcu gcucucu ggggguuucaucc augag ggcguucccccg aa aacaaa uggaggaacgcc ugau gucc gggaaac ccccaggugg

>GPX1_eriEur Erinaceus europaeus (hedgehog) score: 19.31 
auagccgcga gccgcug ggcaucucaucc augac ggcgccgccuuc aa accugcgagcag gaaggagcgcc cgau agc cgcgaga gcccccagcg

>GPX1_canFam Canis familiaris (dog) score: 22.40 
ucacagcgcu gcccucu ggggauuucaucc augau gguguuuccuug aa aucugca uggaggaacgcc ugau uucca ggaaagu ccccugagcu

>GPX1_felCat Felis catus (cat) score: 27.75 
cacagcacug cccucug gggauuucaucc augau ggcguuuccucg aa auuugca uagaggaacgcc ugau uuc cagaag aauccccuga

>GPX1_equCab Equus caballus (horse) score: 27.08
ucacagugcu uuucucu ggggauuucaucc augau ggcguuuccucu aa acaugc augaggaacgcc ugau guu aaggaga aucccccgag

>GPX1_bosTau Bos taurus (cow) score: 29.83 
agucagcgcu gcucucc agggauuuugccc augaa gguguucccucu aa accuacg uggaggaaugcc ugau gucca ggaaaau ccccugaggu

>GPX1_dasNov Dasypus novemcinctus (armadillo) score: 28.92
uguccuccac acggggu uuucaucc augac gguguuuccucu aa accugca gggaggaacacc ugaa guccggcaaa aucccc cgagaugggu

>GPX1_dasNov Dasypus novemcinctus (armadillo) score: 28.92
uguccuccac acggggu uuucaucc augac gguguuuccucu aa accugca gggaggaacacc ugaa guccggcaaa aucccc cgagaugggu

>GPX1_choHof Choloepus hoffmanni (sloth) score: 17 T2 frag
GGGGTTTCATC CATGACGGTGTTTCCTCTAAACTATATGGAGGAACCCTGAA GCCCGGAAAAATCCCCCAAAAT

>GPX1_loxAfr Loxodonta africana (elephant) score: 25 genomic 3' found with difficulty
GCUUUCCGUG GGGGUUU CAUUA AUGAG GGUGUUUUCUCU AA ACCUGAAU GGAGGAACACC UGAU GUCUGGG AAGAUAC CCCCCAGAUA

>GPX1_echTel Echinops telfairi (tenrec) score: 22
CGCGGCCUGC CUUGCGU GGGGACUUCAUCA  AUGAG  GGUGUUUCUUCU  AA  ACCCGAAU GGAGGAACACC CGAU GUCC GGGAAAG CCCCCCGCAG

>GPX1_monDom Monodelphis domestica (opossum) score: 26.38 
gugcuaaggg uccguga ggguuuuaucu augau gguguuguuuu aa accauuaagga gaaagaacacu ugau aaugc uuguaa aaucccauga

>GPX1_macEug Macropus eugenii (wallaby) trace score: 33 [prob as mondom1=mondom2]
GCUGGUAAUC CAUGUGG AUUUUAUCU  AUGAU  AGUGUUCUUUUU  AA  ACCUUUACG GAGAAAGAACACU UGAU GUUG CUUAUA AAAUCCGCAU

>GPX1_ornAna Ornithorhynchus anatinus (platypus) score: 25.55
ugcuauuugc ccauggg ggagaucucauuu augau ggugcuccuucu aa accuuua cggaagagcacu ugau gga uccugag gaacuccaug

>GPX1_anoCar Anolis carolinensis (lizard) score: 18
UUUCUAUUCU CUAUCAA AAUUUUAUUC  AUGAU  GGUGCUUUUUCU  AA  AGCCU UGAAAAGCACU UGAU UUUCUAAAAG UUUGUG UGAAGCUAUA

GPX2: 17 SECIS insertion sequences

>GPX2_homSap Homo sapiens (human) score: 29.54 
AGACUUGGGU AAGCUCU GGGCCUUCACAGA AUGAU GGCACCUUCCU AA ACCCUCA UGGGUGGUGUC UGAG AGGCGUGA AGGGCCU GGAGCCACUC

>GPX2_panTro Pan troglodytes (chimp) score: 29.54 
agacuugggu aagcucu gggccuucacaga augau ggcaccuuccu aa acccuca ugggugguguc ugag aggcguga agggccu ggagccacuc

>GPX2_macMul Macaca mulatta (rhesus) score: 29.54
agacuugggu aagcucu gggccuucacaga augau ggcaccuuccu aa acccuca ugggugguguc ugag aggcguga agggccu gaagccaccc

>GPX2_otoGar Otolemur garnettii (bushbaby) score: 27.86 
agacuugggu gggcucu gggccuucacaga augau ggcaccauccu aa acgccuc ugggugguguc ugag aagagcg gaaggcc uggagccacc

>GPX2_tupBel Tupaia belangeri (treeShrew) score: 28.69 
agacuuaggu gggcucu gagccuucacaga augau agcaccuuccu aa acccccc cgggagguguc ugag aagugug acaggcc cggagccagc

>GPX2_musMus Mus musculus (mouse) score: 33.65 
agucuggggu agguucu gggccuucacaga augau ggcaucuuccu aa acccuuc ugggagauguc ugag aaguugug aaggguc cagagccagu

>GPX2_ratNor Rattus norvegicus (rat) score: 30.80 
cugggguagg ugcuagg ccuucuucacaga augau ggcaucuuccu aa acccuuc ugggggauguc ugag acg uugugaa gggcccagag

>GPX2_cavPor Cavia porcellus (guineaPig) score: 20.08 
cuaggacagg uggcucu gggccuucacaga augac ggcaccguccu aa acgcua ugggugguauc ugag aagugug aauggcug gagccagccu

>GPX2_sorAra Sorex araneus (shrew) score: 29.00 
aagcuggggc aaacucu gggccuucgcaga augau ggcaccucccu aa auccau ggggugguguc ugag gcgugcg agggccu ggaaacagcc

>GPX2_eriEur Erinaceus europaeus (hedgehog) score: 25.06 
aaagcugggu gguuucu ggaccuucacaga augau agcaccuuccu aa accuaua gggaugguguc ugag aaaugu gaagggc cugaaguaaa

>GPX2_canFam Canis familiaris (dog) score: 22.57 
aagacuuggg uggcucu gggccuucacaga augau ggcaccuuccu aa auagua ugggcgguguc ugag aagugug aagggcu cagagccagc

>GPX2_felCat Felis catus (cat) score: 22.45 
aagacuuggg uggaucu gggccuucacaga augau ggcaucuuccu aa acugua ugggcgguguc ugag gaguguga agggcu cggagccagc

>GPX2_equCab Equus caballus (horse) score: 28.45
agacuucggu aggcucu gggccuucacaga augau ggcaccuuccu aa accugua uggacgguguc ugaa aagcgug aagggcc ccgagucagc

>GPX2_bosTau Bos taurus (cow) score: 26.14
agacaugggu gggcucu gugucuucacaga augau ggcaccuuccu aa aucugua ugggcgguguu ugag aagagu gaaggcc uggagccagc

>GPX2_choHof Choloepus hoffmanni (sloth) score: 27
GACUUGGGUA gGCUCUG GGCCUUCACAGA AUGAc GGCACCUUCCU AA ACCuUuA UGGGUGGUGUu UGAG Aac ucaguGU GAAaGGCCUG

>GPX2_loxAfr Loxodonta africana (elephant) score: 27 genomic 3'
AGACUUGGGU AgGCUCU GGaCCUUCgCAGA AUGAU GGCACCUUCCU AA ACucag UGGGUGGUGUC UGAG AaauGUG AAGGGCCU agggccagcc

>GPX2_echTel Echinops telfairi (tenrec) score: 30
AGUGCUGGUG UGGCUCU GGGCCUUCACAGA  AUGAU  GGCACCUUCCU  AA  ACCCUC CGGAAGGUGUC UGAG AAAUGUG AAGGGCC UGGGGCCGGC

>GPX2_monDom Monodelphis domestica (opossum) score: 33 
ACUCCAAAAU CUGGGUU GGCUCUUCACAGG  AUGAU  AGCAUCUUCUU  AA  ACCCUUGAGGGG GAAUGAGAUGCU UGAG AGUCGUGAA GAGCUUA AUUCUAGCCU

>GPX2_macEug Macropus eugenii (wallaby) trace score: 37
ACUCCAAGGU CUAGGUU GGCUCUUCACAGG  AUGAU  GGUAUCUUCUU  AA  ACCCUUGGGGGA GGGAGGAUGCC UGAG AGUCGUGAA GAGCUUG AAUUCUAGUC

>GPX2_ornAna Ornithorhynchus anatinus (platypus) score: 27.55
gggcucgagc agccucc agaccuucacaga augac ggugucuccuu aa acccuaac cgggaggcacc cgag agccggu gaagggc cuggugacug

>GPX2_anoCar Anolis carolinensis (lizard) score: 14 supported by position and 28way
gccaauauca gaucuuu acuaa  uugac  gguguccuccu  aa  agcucaac agagggaacc ugaa gcaug uaaaggu gcugauccca

GPX4: 14 SECIS sequences

>GPX4_homSap Homo sapiens (human) score: 29.19
CCACGCCCUU GGAGCCU UCCACCGGCACUC AUGAC GGCCUGCCUG CA AACCUGCUGGU GGGGCAGACC CGAA AAUCC AGCGUGC ACCCCGCCGG

>GPX4_panTro Pan troglodytes (chimp) score: 29.19
CCACGCCCUC GGAGCCU UCCACCAGCACCC AUGAc ggccugccug ca aaccugcuggu ggggcagacc cgaa aaucc agcgugc acccugccgg

>GPX4_macMul Macaca mulatta (rhesus) score: 33.09
CCACGCCCUC GGAGCCU UCCACCGGCACCC AUGAc ggccugcuugc aa accagcuccuggu gaggcagacc cgaa aaucc agcgugc accccgcugg

>GPX4_tupBel Tupaia belangeri (treeShrew) score: 31.05 
CCGCGCCCCG GAACCUU CCACCCGGCACCU UUGAc ggucugccuau aa accugccacug gugaggcagacc cgag aaccu ggcgugc acccugccgg

>GPX4_musMus Mus musculus (mouse) score: 35.62 
UGACCCCUGG AGCCUUC CACCCCGGCACUC AUGAa ggucugccug aa aaccagccugcuggu ggggcagucc ugag gaccu ggcgugc acccugccgg

>GPX4_ratNor Rattus norvegicus (rat) score: 34.33
UGACCCCUGG AGCCUUC CACCCCGGCACUC AUGAc ggucugccug aa aaccagcccgcuggu ggggcagucc cgag gaccu ggcgugc accccgccgg

>GPX4_cavPor Cavia porcellus (guineaPig) score: 34.46 
UGGCCGCCCC GAGUCUC CUACCCGGGUGCC AUGAc ggccugccug ca aaccagcgug cugguggggc agac ccg aggaugc gugcacugcc

>GPX4_canFam Canis familiaris (dog) score: 31.12 
AUGCCCCUCG GAGCCUU CCACCCGGCACCC AUGAc agucugucuaa aa accagcccgcugg uggggcagacc cgag aaccc ggcgugc acccugccgg

>GPX4_sorAra Sorex araneus (shrew) score: 36.85 
CUGCCCCUCG GAGCCUU CCACCCGGCGCCC AUGAc ggucugccugc aa accagccc gcugguggggc agac ccgagaaccc ggcgugc accuugccgg

>GPX4_loxAfr Loxodonta africana (elephant) score: 34 traces with coding no genomic
GCGCUUCUCA AGCCUUC CACCCGGCACCC AUGAC GGCCUGCUUGC AA ACCAGCCCGCUGGU GAGGCAGACC CGAG AACCU GGCGUGC ACCUCUGCCG

>GPX4_echTel Echinops telfairi (tenrec) score: 40.88
UUGAUCCCCA GAGUCUU CCACCCGGCACCA AUGAc ggucugccuuc aa accaggccucugg ugaggcagacc cgau gaccc ggcgugc acucagccgg

>GPX4_monDom Monodelphis domestica (opossum) score: 40.88 
UUGAUCCCCA GAGUCUU CCACCCGGCACCA AUGAC GGUCUGCCUUC AA ACCAGGCCUCUGG UGAGGCAGACC CGAU GACCC GGCGUGC ACCUCAGCCG

>GPX4_macEug Macropus eugenii mRNA score: 22.86 T2
AGTCTTCCACCCGGCACC AATGACGGTCTGCCTTCAACCAGGTCACTGGTGGGGTAGACTCGAC AACCCGGCGTGCATCTCAGCCG

>GPX4_ornAna Ornithorhynchus anatinus (platypus) score: 33.89
ACCUCCGCUU UCCCGGG ACGCUCUGCCUCC AUGAc ggccggccuu ca agccaaaaccaguugg uggggccggcc ugaa caa accggca cgggucccgg

>GPX4_anoCar Anolis carolinensis (lizard) score: 38.77
UGCUCCCCGU GGGCCCC CUCCUCCAGCACC AUGAc ggccugccuug aa gccagcuugcugg ugaggcagacc cgaa gauuc ggcgugc acugcuggag

>GPX4_galGal Gallus gallus (chicken) score: 38.77
UGCUCCCCGU GGGCCCC CUCCUCCAGCACC AUGAc ggccugccuug aa gccagcuugcugg ugaggcagacc cgaa gauuc ggcgugc acugcuggag

>GPX4_taeGut Taeniopygia guttata (finch) score: 34
ccugcugccc acggagc cuccuccagcccc  augac  gggcugccucc  aa  uccagcugcugg uggggcagccc cgac ccgaggcgu gcagcug cuggacagaa

SEPW: 13 SECIS sequences

>SEPW_homSap Homo sapiens (human) score: 36.01
GACCCAGCCC CUCUCAG CAGACGCUUC AUGAU AGGAAGGACUG AA AAGUCUUGUGGACACC UGGUCUUUCCC UGAU GUU CUCGUGG CUGCUGUUGG

>SEPW_panTro Pan troglodytes (chimp) score: 36.01
GACCCAGCCC CUCUCAG CAGACGCUUC AUGAU AGGAAGGACUG AA AAGUCUUGUGGACACC UGGUCUUUCCC UGAU GUU CUuGUGG CUGCUGUUGG

>SEPW_ponPyg Pongo pygmaeus (orang) score: 30.55
GACCCAGCCC CUCUCAG CAGACGCUUC AUGAU AGGAAGGACUG AA AAAUCUUGUGGACACC UGGUCUUUCCC UGAU GUU CUCGUGG CUGCUGUUGG

>SEPW_macMul Macaca mulatta (rhesus) score: 33.55
GACCCAGCCC CUCUCAG CAGACGCUUC AUGAU AGGAAGGACUG AA AAGUCUUGUGGACgCC UGGUCUUUCCC UGAU GUU CUCGUGG CUGCUGUUGG

>SEPW_musMus Mus musculus (mouse) score: 34.04
UUGGCCCAGC CCCUCGU GGCAGACGCUUC AUGAU GGGAAGAACUG AA AUGUCUCGUGGACGC CUGGUCUUUCC CUGAU GUCCCU GCGACUG CCACGUAGGG

>SEPW_ratNor Rattus norvegicus (rat) score: 26.55
UGGCCGGCCU UUCUUGG CAGCCGCUUC AUGAC AGGAAGGACUG AA AUGUCUCAAAGACCUG UGGUCUUUCUU CGAU GUU CCUGCGG CCACCAAGUC

>SEPW_canFam Canis familiaris (dog) score: 34.04
UUGGCCCAGC CCCUCGU GGCAGACGCUUC AUGAU GGGAAGAACU GA AAUGUCUCGUGGACGCC UGGUCUUUCC CUGAU GUCCCU GCGACUG CCACGUAGGG

>SEPW_dasNov Dasypus novemcinctus (armadillo) score: 28.71
CCCAGCUGCC CUUGGCA GACGCUUC AUGAG GGGAAGGACCU AA AUGCGUCGUGGAUGCC UGGUCUUUCCC UGAU GCUCCUUCAC CUGCCAG AUGGGGCAGA

>SEPW_choHof Choloepus hoffmanni (sloth) score: 38
CUUGGCCCAG CCGCCCU CGGCAGACGCUUC  AUGAG  GGGAAGGACUG  AA  AUGUCUCACGGAUCC UGGUCCUUCCC UGAU GUCCCU GCGGCUG CUGGGUGGGG

>SEPW_loxAfr Loxodonta africana (elephant) score: 19 genomic 3'
UGGCCCAGCC CCUUUCA GCAGACACUUC AUGAC AGGAGGACUGA AA UGUCUCCCAGACGC CUGGUCUUUCC CUGAA UCUGUCGGC UGCAGG ACAGGGCAGC

>SEPW_echTel Echinops telfairi (tenrec) score: 25 T2
TGGCCCAGCCCCTCCTGGCAGACGCTT CATGACAGGAAGGACCGAAATGTCTTCTGGACGGGTGGTCTTTCCCAGAA TCCCCCGCGGCTGCTGGGC

>SEPW_monDom  Monodelphis domestica (opossum) score: 27
CCUCGUCUCG GCCCCUG CCCCCGAUGCUCC  AUGAC  GGGAAGGAUCG  AA  AUGUCCUCAGGAUUCC UGGUUCUUCCC UGAA AUCCUCG CAGCUGU UGGGCUGGGG

>SEPW_macEug Macropus eugenii (wallaby) trace score: 8 T2
CCTTGTCTCCATCCCTGCCCATAAATGCTTTATGACCA GAATGATGGAAATGTCCTCTGGATTCCTGGTTCTTCCCTGA AATTCTTGCACTCATTGGGCTGGGG

>SEPW_ornAna Ornithorhynchus anatinus (platypus) score: 
cggccccacc cccuccg cccagacgcuug  augac  gggagcgacug  aa  augucucuggacgc guggucguuccc ugag gccccgcgu cggcugg cggaagggau

>SEPW_anoCar Anolis carolinensis (lizard) score: 29
UCUGUUUUGU UCAUCUU GGCCGAGCGCUUG  AUGAC  GGGAUCUGCUG  AA  AUGUCGUCAGAUGCG UGGCAGUUCCC UGAA ACCCUU GUGUAGA AUGCCAUUUU

DIO1: 9 SECIS sequences

>DIO1_homSap Homo sapiens (human) score: 29.16
uuuuaacucu gugucuu uacauauuuguuu augau ggccacagccu aa aguacaca cggcugugacu ugau ucaa aagaaa auguuauaag
>DIO1_dasNov Dasypus novemcinctus (armadillo) score: 28 T2
TTTTAACTCTGctTCTTTtCATATTTGTT TATGATGGCCACAGttTAAAGTACAtACaGCTGTGACTTGAT atgaAAAAGAAAtattttaa

>DIO1_choHof Choloepus hoffmanni (sloth) score: 21 T2
TTTTAACTCTGctTCTTTtCATATTTGTT TATGAcGGCCACAGCCTAAAGTACAtAaaGCTGTGACTTGAT TtgaaaaAAAAaAAAATGTTtTAAG

>DIO1_loxAfr Loxodonta africana (elephant) score: 22 T2 genomic 3' note pseudogene
TTTTAACTCTGCTTCTTTTCATGTATTTATGATG g GCCACAGCCTAAAGTGCACAACAGCTGTGACTTGATTTGAA AAACATCTTTAAG

>DIO1_echTel Echinops telfairi (tenrec) score: 25
UGCUUUAACU CUGCUUC UUUCCAUAUGUUU  AUGAU  GGCCACAGCUU  AA  AGUACACAA CAGCUGUGACU UGAG CGAA AAAUGUA UUUUAAGAUG

>DIO1_monDom  Monodelphis domestica (opossum) score: 12
UUUCCAUCCU GCUUCUA CAAAUAUUUAUUU  AUGAC  AAUCACAGCCU  AA  AGCUCAGGGC AGCUGGGAUU CGAC GGGAG AAAAAGU UUGUAAGAGG

>DIO1_macEug Macropus eugenii (wallaby) score: 23
UUUCAAACCU CCUUUUG UGAAUAUUUUUUU  AUGAC  AGUCAUAGCUU  AA  AGCUCAGGC CAGCUGAGACU CGAU GUGA GAAAAUG UUUGUAAGAG

>DIO1_ornAna Ornithorhynchus anatinus (platypus) score: 23.83
cccggauccg guuccgu gaauauugguuu augag ggucacagugu aa agcgcaug cagcugugacu ugau cug agaaaau auuucugcgg

>DIO1_galGal Gallus gallus (chicken) score: 23
CUCUUGACAU UUGUUUC UAUAAUAUUUGUC  AUGAC  AGUCACAGCAU  AA  AGCACAGAC GGCUGUGACC UGAU UUU AGAAAA UAUUUUUAGA

>DIO1_taeGut Taeniopygia guttata (finch) score: 26
UAUCAGCAUC UGUUUCU AUGAGUAUUUGUU  AUGAU  GGUCCCAGCCU  AA  AGCACUGG UGGCUGUGACC UGAU UCU AGAGAA UAUUUAUAGA

>DIO1_anoCar Anolis carolinensis (lizard) score: 25
ACUUCAUUUU GUUUCUA UUUGUAUUUAUUU AUGAU AGUCAUAGCUU AA AGCAUGAA GAGCUGUGGCC UGAU UUGG AAAAAAU AUUGAUAGAA

>DIO1_xenTro Xenopus tropicalis (frog) score:  22
gcucuacaac uccacaa uguauuuguua  gugac  gguugcagcuu  aa  agcacaga uggcuucuacc ugau guugcaaagc auuguga gugcuuaaua

>DIO1_calMil Callorhinchus milii (elephantfish) score: 18.25 513 stop 591-684 SECIS
uaccaaagga acucucu cccuuauucaga augau uuucucagccuu aa acgcu guggcugggagc ugau guguugaau acggag aaacagcucu

DIO2: 12 SECIS insertion sequences

>DIO2_homSap Homo sapiens (human) score: 29.74
cagagaugug cagaguu gaccagugugcgg augau aacuacugacg aa agagucaucgacuc aguuagugguu ggau guaguc acauuag uuugccucuc

>DIO2_macMul Macaca mulatta (rhesus) score: 29.74
cagagaugug cagaguu gaccagugugcgg augau aacuacugacg aa agagucaucgacuc aguuagugguu ggau guaguc acauuag uuugccucuc

>DIO2_musMus Mus musculus (mouse) score: 29.14
cggagauguu cagagcu cacuggugugcga augau aacuacugacg aa agagcugucugcuc agucugugguu ggau guagucacac gagucug ccuuucugca

>DIO2_ratNor Rattus norvegicus (rat) score: 27.88
ccgagauguu cggagcu cacuggugugcga augau aacuacugacg aa agagucaucugcuc agucugugguu ggau guagucacac gagucug ccucuccauc

>DIO2_canFam Canis familiaris (dog) score: 27.29
cugggaugug cagaggu gaccagugugcga augau aacuacugaug aa agagucacugacuc aguuagugguu ggau aca gucacau uaguuuuccu

>DIO2_dasNov Dasypus novemcinctus (armadillo) score: 26.93
cugggaaguu cagaggc uaccagugugcca augau aacuacugacg aa agaggcaucgacuc aguuagugguu ggau gua gccacau uaguuugccu

>DIO2_dasNov Dasypus novemcinctus (armadillo) score: 27 T2
ACCAGTGTGCc aATGATAACTACTGACGAAAGAGgCATCGACTCAGTTAGTGGTTGGAT GTAGcCACATTAGTTTGCCTCTC

>DIO2_choHof Choloepus hoffmanni (sloth) score: 25
CUGAGAAGUU CAGAGGC UGCCAAUGUGCGA  AUGAU  AACUACUGAC  AA  AAGAGGCAUUGACUC AGUUAGUGGUU GGAU GUA GUCACAU UAGGUUGCCU

>DIO2_loxAfr Loxodonta africana (elephant) score: 25 traces lacking coding
CUGGGAUGUG CAGAGGC UACUAGUGUGCAA AUGAU AACUGCUGACG AA AGAGGCACUGACU CAGUUAGUGGUU GGAU GUA GUCACAU UGGUUUGCCU

>DIO2_echTel Echinops telfairi (tenrec) score: 24
CCAGGAUGUG CAGAGGC AACUAGUGUGCAA  AUGAU  AACUGCUGAUG  AA  AGAGGCACCGACU CAGUUAGUGGUU GGAU GUAGU CACACUG GUAUGCCUCU

>DIO2_monDom Monodelphis domestica (opossum) score: 29
ccaaggugUG GAAGGGC UGCCAGUGUGCAA AUGAU GAuCuCUAAC aA AAGAGUCaGUCACUC cGUUAGAGGUU GGAU GUGGUCACA GUGGCUU GCUgcucccu

>DIO2_macEug Macropus eugenii mRNA score: 28
ccaaguuaug gaagggc ugccagugugcaa augau gaccccuaacg aa agagucugucacuc aguuagagguu ggau guggucaca guggcuu gcuacuacau

>DIO2_ornAna Ornithorhynchus anatinus (platypus) score: 24.54
ccaggauagg gcugagu uacuagugugcaa augaa gaccaccaaca aa agagaauuuaacuc aguuggugcuc agau auc aucacac uggcuuacuu

>DIO2_galGal Gallus gallus (chicken) score: 24.57
ggggugaaac cugaaug cuuguguguuu augaa gagcacuaaca aa agaguaauugacuc aguugguguuc agau acucuca cacugg cauuccucug

>DIO2_taeGut Taeniopygia guttata (finch) score: 25
UGGGGUGAGA CAGAGGA AGCUUGUGUGCUC  AUGAA  GAUUGCUAAC  AA  AAGAGUGAUUAACUCA GUUAGCUUUC AGAU GCU UUCACG CUGGCAUUCC

DIO3: 10 SECIS insertion sequences

>DIO3_homSap Homo sapiens (human) score: 31
uugggugcac aggagcc ccacugcug augac gaacuaucucu aa cuggucuugacca cgagcuaguuc ugaa uugca ggggccu caaagcagca

>DIO3_panTro Pan troglodytes (chimp) score 30.95
uugggugcac aggagcc ccacugcug augac gaacuaucucu aa cuggucuugacca cgagcuaguuc ugaa uugca ggggccu caaagcagca

>DIO3_macMul Macaca mulatta (rhesus) score: 30 
uugggugcac aggagcc ccacugcug augac gaacugucucu aa cuggucuugacca cgagcuaguuc ugaa uugca ggggccu caaaacagca

>DIO3_musMus Mus musculus (mouse) score: 26 
gugcgcugga gcccugg cugcug augac gaaccgccucu aa cugggcuugaccac gggucggcuc ugaa uugca gagaggc ucgaaacagc

>DIO3_ratNor Rattus norvegicus (rat) score: 26 
gugcgcugga gcccugg cugcug augac gaaccgccucu aa cugggcuugaccac gggucggcuc ugaa uugca gagaggc ucgaaacagc

>DIO3_cavPor Cavia porcellus (guineaPig) score 24.06
uguuuugggc gcgcaug agccccucugcug augac gaacugucccu aa cuggucucgacc acgggcggguu ccgaa auug caggaug gcucgaaucg

>DIO3_canFam Canis familiaris (dog) score 25.84
uauuuugggu gcuggcg agccccacugcug augac gagccgccucu aa cuggucuugacca cgagcugguuc ugag uugcagggg ggcuugc agcggcgccu

>DIO3_felCat Felis catus (cat) score 29.2
cauuuggggu gcucacg agccccacugcug augac gagcuaucucu aa cuggucuugacca cgagcugguuc ugaa ccgc agggggc uugcagcagc

>DIO3_bosTau Bos taurus (cow) score 23.46
uauuuugggu gcucacg agccccacugcug augaa gagcugucucu aa cuggccucgacca cgagcugguuc ugau uugc aggaggc ucgcagcagc

>DIO3_choHof score: 23
UGUUUUUGGU GUGCACG AGCCCCGCUGCUG  AUGAC  GAACUGUCUCU  AA  CUGGUCUCGACCA CGAGGCGAUUC CGAA UUGCGGGG AGCUCGC AGCAGCGCCU

>DIO3_dasNov Dasypus novemcinctus (armadillo) score: 18
UGAUUUGGGU GCGUGCG AGCCCCGCUGCUG  AUGAC  GAGCUGUCUCU  AA  CUGGUCUCGACCA AGAGGCGAGUC CGAA UUGC CGGGGGC UCGCCGCAGC

>DIO3_choHof Choloepus hoffmanni (sloth) score: 23
UGUUUUUGGU GUGCACG AGCCCCGCUGCUG  AUGAC  GAACUGUCUCU  AA  CUGGUCUCGACCA CGAGGCGAUUC CGAA UUGCGGGG AGCUCGC AGCAGCGCCU

>DIO3_loxAfr Loxodonta africana (elephant) score: 22 genomic 3'
uguuuucggu gcgcuaG AGCCCCACUGCUG AUGAC GAACUgUCUCU AA CUGGUCUUGACCAC GAGCUgaUUC cGAA UUGCAGGGaa cucgcagc agcgccuaaa

>DIO3_echTel Echinops telfairi (tenrec) score: 15 T2
TGTTTTCGGTGCTCTGCAGCCCCACTGCT GATGACGAACTGCCTCTCACTGGTCTTGACCACGAGCTGCTTCTGAA ATGCAGGGGACTCGCAGCCGCACCTAAA

>DIO3_monDom  Monodelphis domestica (opossum) score: 22
GUUCUGGCAC UUCUUUG GUCCCUCUGGUA  GUGAC  GACCUGUUUCG  AA  UUGGUCCCAGACCAG GAAACCGUGUC UGAU AUUC UUAGCGA CCUAGAAGUG

>DIO3_macEug Macropus eugenii (wallaby) trace score: 12 T2
TCTAGCACTTCTATGGTCCCTAAGGTA GAGACGACCTGTTTAGAATTGGTCCCAGACCAGGAAACCGTGTCTGAT ATTAAAAATGACCTAGAAGTG

>DIO3_galGal Gallus gallus (chicken) score: 15
AGUGCUAACU GGGAUUU CUAGUAUUUCUUU GUGAU GACCGAUUUUG AA AUGGGUUUCUCUAAUGCCAG GAAAUCGUGUC UGAU GUUGUC AAGUACU AGAACUGCCA

>DIO3_taeGut Taeniopygia guttata (finch) score: 13
AGUGCUAACU GGGAUUU CUAGUAUUUCUUU  GUGAU  GACCGAUUUUG  AA  AUGGGUUUCUCUAAUGCCAG GAAAUCGCGUC UGAU GUUGUC AAAUACU AGAACUGCCA

>DIO3_xenTro Xenopus tropicalis (frog) score: 29
cacugacucu gcaggug uuugcaa  augac  gaccgauuuug  aa  augguuucacggccaa aaacucguguc ugac acc ccuucc uuccccaaac

>DIO3_chiPun Chiloscyllium punctatum (shark) score: 26 EU275162 form 2
gaauucgcag guauucu ugacacuuuuuuu  augaa  agccgguuuuu  aa  auggccucagugccag gaaaccacgcc ugau gug acaaagu guuugggaua

SELM2: 16 non-canonical SECIS insertion sequences

>SELM2_homSap Homo sapiens (human) score: non-canonical 
ggggacgggcatcggctctcagcaagagaagtattcccgggatgctgagcgcttcattctgtctcc 

>SELM2_panTro Pan troglodytes (chimp) score: non-canonical 
ggggacgggcatcggctctcagcaagagaagtattcccgggatgctgagcgcttcattctgtctcc 

>SELM2_macMul Macaca mulatta (rhesus) score: non-canonical 
ggggacggggcatcggccctcagcaagagaggtattcccgggatgctgagcgcttcattctgtctcc 

>SELM2_tupBel Tupaia belangeri (treeShrew) score: non-canonical 
ggggacagcacatcggcccccagcaagggaggtgctcccgggatgctgagcgcttcattcggtctcc 

>SELM2_musMus Mus musculus (mouse) score: non-canonical 
ggagactggcgtcggccctcagcaagggagatgctcccgggatactgagcgcttcattctgtctcc 

>SELM2_ratNor Rattus norvegicus (rat) score: non-canonical 
ggagaccggcgtcggccctcagcaagagagtttatgctcccgggatgctgagcgcttcattctgtctcc 

>SELM2_cavPor Cavia porcellus (guineaPig) score: non-canonical 
agacgggcatcggtcctcagcaagggagatgctcccgggatgctgagcacttcattcggtcttc 

>SELM2_oryCun Oryctolagus cuniculus (rabbit) score: non-canonical 
ggggacggggcgtcggccctcagcaagggagggggctcccgggatgctgagcgcttcatcgtgtctccc 

>SELM2_sorAra Sorex araneus (shrew) score: non-canonical 
ggggacggggcgtcgaccctcagcgagggagtgctcccgggacactgagggcttcattctgtcccc 

>SELM2_canFam Canis familiaris (dog) score: non-canonical 
tgggacgaggcatcggccctcagcgagggagacgctcccgggacgctgagcgcttcattctgtcccc 

>SELM2_felCat Felis catus (cat) score: non-canonical 
tgggacggggcgtcggccctcagcgagggaggtgttcccgggacgctgagcgcttcattctgtcccc 

>SELM2_equCab Equus caballus (horse) score: non-canonical 
cgggaccgagcgtcggccctcagcgagggaggtgctcccgggacgctgaacgcttcattctgtcccc 

>SELM2_bosTau Bos taurus (cow) score: non-canonical 
ggggacggggcgtcggccctcaacgagggaggtgctcccgggccgctgagcgcttcattctgtcccc 

>SELM2_dasNov Dasypus novemcinctus (armadillo) score: non-canonical 
taggacagggcgtcggccctcagcgagggagatgctcccgggccgctgagcgcttcattcggtcccc 

>SELM2_anoCar Anolis carolinensis (lizard) score: non-canonical 
agggacgctgtctatccaccctcggcggcaagagctttcgtccgagggcttcatcctgtcccg 

MSRB2: 0 SECIS insertion sequences (lack selenocysteine)

MSRB3: 0 SECIS insertion sequences (lack selenocysteine)

GPX5: 0 SECIS sequences (cysteine all species)

GPX7: 0 SECIS sequences (all species have cysteine)

GPX8: 0 SECIS sequences (all species have cysteine or serine)

SELU1: 0 SECIS sequences (none in vertebrates)

SELU2: 0 SECIS sequences (none in vertebrates)

SELU3: 0 SECIS sequences (none in vertebrates)

SEPHS1: 0 SECIS sequences (none in vertebrates)

Personal tools