https://genomewiki.ucsc.edu/index.php?title=Opsin_evolution:_update_blog&feed=atom&action=history
Opsin evolution: update blog - Revision history
2024-03-28T16:42:48Z
Revision history for this page on the wiki
MediaWiki 1.38.4
https://genomewiki.ucsc.edu/index.php?title=Opsin_evolution:_update_blog&diff=21836&oldid=prev
Tomemerald at 20:49, 19 April 2014
2014-04-19T20:49:21Z
<p></p>
<table style="background-color: #fff; color: #202122;" data-mw="interface">
<col class="diff-marker" />
<col class="diff-content" />
<col class="diff-marker" />
<col class="diff-content" />
<tr class="diff-title" lang="en">
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">← Older revision</td>
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">Revision as of 20:49, 19 April 2014</td>
</tr><tr><td colspan="2" class="diff-lineno" id="mw-diff-left-l196">Line 196:</td>
<td colspan="2" class="diff-lineno">Line 196:</td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 27 Nov 07: reorganized curated sequences into deuterostome, ecdysozoa, lophotrochozoa blocks sorted by receptor type.</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 27 Nov 07: reorganized curated sequences into deuterostome, ecdysozoa, lophotrochozoa blocks sorted by receptor type.</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><br/></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><br/></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> site visits: 2008 2009 2010 2011 2012</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> site visits: 2008 2009 2010 2011 2012 <ins style="font-weight: bold; text-decoration: none;"> 2014</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> #pages topic 22 Apr 12 May 29 Jul 4 Sep 4 Nov 3 Jan 8 Feb 26 Mar 2 Jun 5 Sep 8 Dec 6 Mar 6 Jun 13 Sep 21 Jan 22 May 7 Sep 2 Jan 18 May</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> #pages topic 22 Apr 12 May 29 Jul 4 Sep 4 Nov 3 Jan 8 Feb 26 Mar 2 Jun 5 Sep 8 Dec 6 Mar 6 Jun 13 Sep 21 Jan 22 May 7 Sep 2 Jan 18 May <ins style="font-weight: bold; text-decoration: none;">18 Apr</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 47 main 814 896 1076 1227 1706 1919 2123 2380 2693 3128 3561 4181 4570 4938 5418 6091 6798 7510 9171</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 47 main 814 896 1076 1227 1706 1919 2123 2380 2693 3128 3561 4181 4570 4938 5418 6091 6798 7510 9171 <ins style="font-weight: bold; text-decoration: none;"> 23391</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 14 key.deuterostomes 0 0 107 170 250 385 447 631 907 1104 1460 1680 1835 2073 2377 2720 3222 3718 4942</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 14 key.deuterostomes 0 0 107 170 250 385 447 631 907 1104 1460 1680 1835 2073 2377 2720 3222 3718 4942 <ins style="font-weight: bold; text-decoration: none;"> 18253</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 32 key.ecdysozoa 1106 1207 1279 1351 1492 1685 1766 2009 2324 98 245 430 603 855 1121 1471 1877 2242 3398</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 32 key.ecdysozoa 1106 1207 1279 1351 1492 1685 1766 2009 2324 98 245 430 603 855 1121 1471 1877 2242 3398 <ins style="font-weight: bold; text-decoration: none;"> 9232</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 11 key.lophotrochozoa 0 0 0 0 0 0 0 0 0 121 305 432 621 794 1071 1376 1721 2020 2783</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 11 key.lophotrochozoa 0 0 0 0 0 0 0 0 0 121 305 432 621 794 1071 1376 1721 2020 2783 <ins style="font-weight: bold; text-decoration: none;"> 5582</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 25 key.cnidaria 0 0 0 120 209 320 391 515 731 974 1304 1562 1961 2316 2835 3505 4246 5210 6994</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 25 key.cnidaria 0 0 0 120 209 320 391 515 731 974 1304 1562 1961 2316 2835 3505 4246 5210 6994 <ins style="font-weight: bold; text-decoration: none;"> 25284</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 04 opsin.origins 0 0 0 0 0 0 0 0 0 0 0 294 524 761 1056 1395 1691 2085 3094</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 04 opsin.origins 0 0 0 0 0 0 0 0 0 0 0 294 524 761 1056 1395 1691 2085 3094 <ins style="font-weight: bold; text-decoration: none;"> 8306</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 08 alignment 231 256 304 324 380 429 475 555 636 731 872 966 1086 1237 1423 1593 1811 1963 2341</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 08 alignment 231 256 304 324 380 429 475 555 636 731 872 966 1086 1237 1423 1593 1811 1963 2341 <ins style="font-weight: bold; text-decoration: none;"> 3696</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 10 introns 180 202 252 274 340 396 455 548 637 777 980 1203 1435 1674 1891 2188 2485 2708 3556</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 10 introns 180 202 252 274 340 396 455 548 637 777 980 1203 1435 1674 1891 2188 2485 2708 3556 <ins style="font-weight: bold; text-decoration: none;"> 8080</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 02 indels 97 118 157 179 227 284 322 405 521 634 829 1070 1315 1505 1719 2060 2317 2615 3145</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 02 indels 97 118 157 179 227 284 322 405 521 634 829 1070 1315 1505 1719 2060 2317 2615 3145 <ins style="font-weight: bold; text-decoration: none;"> 5949</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 11 ancestral 247 269 318 351 414 476 520 628 765 901 1109 1267 1452 1649 1853 2139 2420 2683 3167</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 11 ancestral 247 269 318 351 414 476 520 628 765 901 1109 1267 1452 1649 1853 2139 2420 2683 3167 <ins style="font-weight: bold; text-decoration: none;"> 5789</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 24 LWS 68 104 169 218 291 338 409 548 665 825 1045 1194 1330 1559 1791 2098 2571 2968 3758</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 24 LWS 68 104 169 218 291 338 409 548 665 825 1045 1194 1330 1559 1791 2098 2571 2968 3758 <ins style="font-weight: bold; text-decoration: none;"> 8390</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 12 encephalopsin 67 110 181 216 286 350 454 625 842 1030 1289 1468 1762 1997 2303 2594 2867 3100 3655</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 12 encephalopsin 67 110 181 216 286 350 454 625 842 1030 1289 1468 1762 1997 2303 2594 2867 3100 3655 <ins style="font-weight: bold; text-decoration: none;"> 5761</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 13 melanopsin 24 70 132 160 207 244 317 424 540 651 802 913 1055 1214 1398 1637 1913 2091 2659</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 13 melanopsin 24 70 132 160 207 244 317 424 540 651 802 913 1055 1214 1398 1637 1913 2091 2659 <ins style="font-weight: bold; text-decoration: none;"> 4790</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 13 RGR.phyloSNPs 98 120 181 200 259 299 528 662 822 983 1178 1339 1532 1728 1995 2275 2639 2915 3810</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 13 RGR.phyloSNPs 98 120 181 200 259 299 528 662 822 983 1178 1339 1532 1728 1995 2275 2639 2915 3810 <ins style="font-weight: bold; text-decoration: none;"> 7457</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 16 peropsin 89 117 174 195 254 332 381 461 573 710 891 1072 1244 1444 1691 1965 2216 2493 3045</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 16 peropsin 89 117 174 195 254 332 381 461 573 710 891 1072 1244 1444 1691 1965 2216 2493 3045 <ins style="font-weight: bold; text-decoration: none;"> 6830</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 15 neuropsin 83 102 164 188 225 264 390 471 558 672 903 1097 1227 1467 1759 1985 2247 2471 3192</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 15 neuropsin 83 102 164 188 225 264 390 471 558 672 903 1097 1227 1467 1759 1985 2247 2471 3192 <ins style="font-weight: bold; text-decoration: none;"> 9972</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 08 platypus 290 338 488 574 743 868 978 1123 1324 1484 1743 1962 2300 2527 2889 3342 3790 4234 4990</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 08 platypus 290 338 488 574 743 868 978 1123 1324 1484 1743 1962 2300 2527 2889 3342 3790 4234 4990 <ins style="font-weight: bold; text-decoration: none;"> 8138</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 06 tricks 169 191 304 343 396 468 530 631 769 938 1253 1438 1622 1854 2113 2365 2697 3072 3950</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 06 tricks 169 191 304 343 396 468 530 631 769 938 1253 1438 1622 1854 2113 2365 2697 3072 3950 <ins style="font-weight: bold; text-decoration: none;"> 7907</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 27 cytoplasmic.face 0 0 0 0 0 0 91 132 277 445 670 814 977 1150 1346 1572 1861 2137 2864</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 27 cytoplasmic.face 0 0 0 0 0 0 91 132 277 445 670 814 977 1150 1346 1572 1861 2137 2864 <ins style="font-weight: bold; text-decoration: none;"> 6526</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 41 RPE.BCO2.BCMO1 0 0 0 0 0 0 85 163 261 447 592 691 869 993 1197 1461 1687 1839 2436</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 41 RPE.BCO2.BCMO1 0 0 0 0 0 0 85 163 261 447 592 691 869 993 1197 1461 1687 1839 2436 <ins style="font-weight: bold; text-decoration: none;"> 4978</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 20 IRBP.(RBP3) 0 0 0 0 0 0 0 339 772 968 1202 1310 1493 1643 1840 2053 2368 2679 3164</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 20 IRBP.(RBP3) 0 0 0 0 0 0 0 339 772 968 1202 1310 1493 1643 1840 2053 2368 2679 3164 <ins style="font-weight: bold; text-decoration: none;"> 5183</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 20 CDH23 0 0 0 0 0 0 0 0 0 162 326 474 709 945 1211 1741 2085 2490 3296</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 20 CDH23 0 0 0 0 0 0 0 0 0 162 326 474 709 945 1211 1741 2085 2490 3296 <ins style="font-weight: bold; text-decoration: none;"> 11970</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 28 USH2A 0 0 0 0 0 0 0 0 0 222 364 480 702 911 1178 1537 1830 2133 2900</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 28 USH2A 0 0 0 0 0 0 0 0 0 222 364 480 702 911 1178 1537 1830 2133 2900 <ins style="font-weight: bold; text-decoration: none;"> 5880</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 17 transducins 0 0 0 0 148 468 378 509 674 918 1164 1345 1538 1802 2063 2402 2722 2976 3437</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 17 transducins 0 0 0 0 148 468 378 509 674 918 1164 1345 1538 1802 2063 2402 2722 2976 3437 <ins style="font-weight: bold; text-decoration: none;"> 5455</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 31 underground 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 782</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 31 underground 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 782 <ins style="font-weight: bold; text-decoration: none;"> 7069</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 03 blog 1178 1329 1798 2158 2610 3179 3412 3960 4599 5436 6211 7002 7860 9107 10354 11987 13540 15422 18726</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 03 blog 1178 1329 1798 2158 2610 3179 3412 3960 4599 5436 6211 7002 7860 9107 10354 11987 13540 15422 18726 <ins style="font-weight: bold; text-decoration: none;"> 36975</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 532 total 4741 5429 7084 8248 10437 12579 14219 17719 21890 26683 30298 35684 41640 48143 55892 65552 75621 85774 109255</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 532 total 4741 5429 7084 8248 10437 12579 14219 17719 21890 26683 30298 35684 41640 48143 55892 65552 75621 85774 109255 <ins style="font-weight: bold; text-decoration: none;">275661</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> ... visits.per.day 31 34 22 31 36 39 49 74 61 50yr 38 61 65 66 69 80 102 87yr 173</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> ... visits.per.day 31 34 22 31 36 39 49 74 61 50yr 38 61 65 66 69 80 102 87yr 173 <ins style="font-weight: bold; text-decoration: none;"> ...</ins></div></td></tr>
<tr><td colspan="2" class="diff-side-deleted"></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> </div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>[[Category:Comparative Genomics]]</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>[[Category:Comparative Genomics]]</div></td></tr>
</table>
Tomemerald
https://genomewiki.ucsc.edu/index.php?title=Opsin_evolution:_update_blog&diff=20006&oldid=prev
Tomemerald at 14:08, 18 May 2012
2012-05-18T14:08:12Z
<p></p>
<table style="background-color: #fff; color: #202122;" data-mw="interface">
<col class="diff-marker" />
<col class="diff-content" />
<col class="diff-marker" />
<col class="diff-content" />
<tr class="diff-title" lang="en">
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">← Older revision</td>
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">Revision as of 14:08, 18 May 2012</td>
</tr><tr><td colspan="2" class="diff-lineno" id="mw-diff-left-l33">Line 33:</td>
<td colspan="2" class="diff-lineno">Line 33:</td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> Reverse Chronological Update Blog</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> Reverse Chronological Update Blog</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> </div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> </div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 14 Apr 12: released major article on [[Cryptochrome_evolution|cryptochrome evolution]], relationships with opsins, with 275 curated [[Cryptochrome_refSeqs|reference <del style="font-weight: bold; text-decoration: none;">sequence</del>]]</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 14 Apr 12: released major article on [[Cryptochrome_evolution|cryptochrome evolution]], relationships with opsins, with 275 curated [[Cryptochrome_refSeqs|reference <ins style="font-weight: bold; text-decoration: none;">sequences</ins>]]</div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 15 Feb 12: started new article on opsins of an [[Opsins_underground|underground mammal]], naked mole-rat</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 15 Feb 12: started new article on opsins of an [[Opsins_underground|underground mammal]], naked mole-rat <ins style="font-weight: bold; text-decoration: none;">(Heterocephalus glaber)</ins></div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> </div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> </div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 30 Dec 11: first nematode opsins located in [[Opsin_evolution:_key_critters_(ecdysozoa)#Nematodes_..._3_opsins|Strongyloides]]</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 30 Dec 11: first nematode opsins located in [[Opsin_evolution:_key_critters_(ecdysozoa)#Nematodes_..._3_opsins|Strongyloides]]</div></td></tr>
</table>
Tomemerald
https://genomewiki.ucsc.edu/index.php?title=Opsin_evolution:_update_blog&diff=20005&oldid=prev
Tomemerald at 14:05, 18 May 2012
2012-05-18T14:05:45Z
<p></p>
<table style="background-color: #fff; color: #202122;" data-mw="interface">
<col class="diff-marker" />
<col class="diff-content" />
<col class="diff-marker" />
<col class="diff-content" />
<tr class="diff-title" lang="en">
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">← Older revision</td>
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">Revision as of 14:05, 18 May 2012</td>
</tr><tr><td colspan="2" class="diff-lineno" id="mw-diff-left-l18">Line 18:</td>
<td colspan="2" class="diff-lineno">Line 18:</td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>* [[Opsin_evolution:_Neuropsin_phyloSNPs|Neuropsin (OPN5): 52 deuterostome genes and a novel paralog, Newropsin]]</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>* [[Opsin_evolution:_Neuropsin_phyloSNPs|Neuropsin (OPN5): 52 deuterostome genes and a novel paralog, Newropsin]]</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>* [[Opsin_evolution:_trichromatic_ancestral_mammal|Color vision in the platypus and ancestral mammal]]</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>* [[Opsin_evolution:_trichromatic_ancestral_mammal|Color vision in the platypus and ancestral mammal]]</div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div>* [[Opsins_underground|Opsins and <del style="font-weight: bold; text-decoration: none;">cryptochrome </del>in a subterranean mammal]]</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div>* [[Opsins_underground|Opsins and <ins style="font-weight: bold; text-decoration: none;">cryptochromes </ins>in a subterranean mammal]]</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>* [[Opsin_evolution:_Cytoplasmic_face|The cytoplasmic face of opsins and GPCR specificity]]</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>* [[Opsin_evolution:_Cytoplasmic_face|The cytoplasmic face of opsins and GPCR specificity]]</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>* [[Opsin_evolution:_RBP3_(IRBP)|IRBP Interstitial retinol-binding protein modules]]</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>* [[Opsin_evolution:_RBP3_(IRBP)|IRBP Interstitial retinol-binding protein modules]]</div></td></tr>
</table>
Tomemerald
https://genomewiki.ucsc.edu/index.php?title=Opsin_evolution:_update_blog&diff=20004&oldid=prev
Tomemerald at 14:05, 18 May 2012
2012-05-18T14:05:18Z
<p></p>
<table style="background-color: #fff; color: #202122;" data-mw="interface">
<col class="diff-marker" />
<col class="diff-content" />
<col class="diff-marker" />
<col class="diff-content" />
<tr class="diff-title" lang="en">
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">← Older revision</td>
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">Revision as of 14:05, 18 May 2012</td>
</tr><tr><td colspan="2" class="diff-lineno" id="mw-diff-left-l18">Line 18:</td>
<td colspan="2" class="diff-lineno">Line 18:</td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>* [[Opsin_evolution:_Neuropsin_phyloSNPs|Neuropsin (OPN5): 52 deuterostome genes and a novel paralog, Newropsin]]</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>* [[Opsin_evolution:_Neuropsin_phyloSNPs|Neuropsin (OPN5): 52 deuterostome genes and a novel paralog, Newropsin]]</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>* [[Opsin_evolution:_trichromatic_ancestral_mammal|Color vision in the platypus and ancestral mammal]]</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>* [[Opsin_evolution:_trichromatic_ancestral_mammal|Color vision in the platypus and ancestral mammal]]</div></td></tr>
<tr><td colspan="2" class="diff-side-deleted"></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div><ins style="font-weight: bold; text-decoration: none;">* [[Opsins_underground|Opsins and cryptochrome in a subterranean mammal]]</ins></div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>* [[Opsin_evolution:_Cytoplasmic_face|The cytoplasmic face of opsins and GPCR specificity]]</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>* [[Opsin_evolution:_Cytoplasmic_face|The cytoplasmic face of opsins and GPCR specificity]]</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>* [[Opsin_evolution:_RBP3_(IRBP)|IRBP Interstitial retinol-binding protein modules]]</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>* [[Opsin_evolution:_RBP3_(IRBP)|IRBP Interstitial retinol-binding protein modules]]</div></td></tr>
<tr><td colspan="2" class="diff-lineno" id="mw-diff-left-l195">Line 195:</td>
<td colspan="2" class="diff-lineno">Line 196:</td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 27 Nov 07: reorganized curated sequences into deuterostome, ecdysozoa, lophotrochozoa blocks sorted by receptor type.</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 27 Nov 07: reorganized curated sequences into deuterostome, ecdysozoa, lophotrochozoa blocks sorted by receptor type.</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><br/></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><br/></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> site visits: 2008 <del style="font-weight: bold; text-decoration: none;"> ... </del>2009 <del style="font-weight: bold; text-decoration: none;"> ... </del>2010 2011 2012</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> site visits: 2008 <ins style="font-weight: bold; text-decoration: none;"> </ins>2009 <ins style="font-weight: bold; text-decoration: none;"> </ins>2010 2011 2012</div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> #pages topic 22 Apr 12 May 29 Jul 4 Sep 4 Nov 3 Jan 8 Feb 26 Mar 2 Jun 5 Sep 8 Dec 6 Mar 6 Jun 13 Sep 21 Jan 22 May 7 Sep 2 Jan</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> #pages topic 22 Apr 12 May 29 Jul 4 Sep 4 Nov 3 Jan 8 Feb 26 Mar 2 Jun 5 Sep 8 Dec 6 Mar 6 Jun 13 Sep 21 Jan 22 May 7 Sep 2 Jan <ins style="font-weight: bold; text-decoration: none;">18 May</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 47 main 814 896 1076 1227 1706 1919 2123 2380 2693 3128 3561 4181 4570 4938 5418 6091 6798 7510</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 47 main 814 896 1076 1227 1706 1919 2123 2380 2693 3128 3561 4181 4570 4938 5418 6091 6798 7510 <ins style="font-weight: bold; text-decoration: none;"> 9171</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 14 key.deuterostomes 0 0 107 170 250 385 447 631 907 1104 1460 1680 1835 2073 2377 2720 3222 3718</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 14 key.deuterostomes 0 0 107 170 250 385 447 631 907 1104 1460 1680 1835 2073 2377 2720 3222 3718 <ins style="font-weight: bold; text-decoration: none;"> 4942</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 32 key.ecdysozoa 1106 1207 1279 1351 1492 1685 1766 2009 2324 98 245 430 603 855 1121 1471 1877 2242</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 32 key.ecdysozoa 1106 1207 1279 1351 1492 1685 1766 2009 2324 98 245 430 603 855 1121 1471 1877 2242 <ins style="font-weight: bold; text-decoration: none;"> 3398</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 11 key.lophotrochozoa 0 0 0 0 0 0 0 0 0 121 305 432 621 794 1071 1376 1721 2020</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 11 key.lophotrochozoa 0 0 0 0 0 0 0 0 0 121 305 432 621 794 1071 1376 1721 2020 <ins style="font-weight: bold; text-decoration: none;"> 2783</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 25 key.cnidaria 0 0 0 120 209 320 391 515 731 974 1304 1562 1961 2316 2835 3505 4246 5210</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 25 key.cnidaria 0 0 0 120 209 320 391 515 731 974 1304 1562 1961 2316 2835 3505 4246 5210 <ins style="font-weight: bold; text-decoration: none;"> 6994</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 04 opsin.origins 0 0 0 0 0 0 0 0 0 0 0 294 524 761 1056 1395 1691 2085</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 04 opsin.origins 0 0 0 0 0 0 0 0 0 0 0 294 524 761 1056 1395 1691 2085 <ins style="font-weight: bold; text-decoration: none;"> 3094</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 08 alignment 231 256 304 324 380 429 475 555 636 731 872 966 1086 1237 1423 1593 1811 1963</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 08 alignment 231 256 304 324 380 429 475 555 636 731 872 966 1086 1237 1423 1593 1811 1963 <ins style="font-weight: bold; text-decoration: none;"> 2341</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 10 introns 180 202 252 274 340 396 455 548 637 777 980 1203 1435 1674 1891 2188 2485 2708</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 10 introns 180 202 252 274 340 396 455 548 637 777 980 1203 1435 1674 1891 2188 2485 2708 <ins style="font-weight: bold; text-decoration: none;"> 3556</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 02 indels 97 118 157 179 227 284 322 405 521 634 829 1070 1315 1505 1719 2060 2317 2615</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 02 indels 97 118 157 179 227 284 322 405 521 634 829 1070 1315 1505 1719 2060 2317 2615 <ins style="font-weight: bold; text-decoration: none;"> 3145</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 11 ancestral 247 269 318 351 414 476 520 628 765 901 1109 1267 1452 1649 1853 2139 2420 2683</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 11 ancestral 247 269 318 351 414 476 520 628 765 901 1109 1267 1452 1649 1853 2139 2420 2683 <ins style="font-weight: bold; text-decoration: none;"> 3167</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 24 LWS 68 104 169 218 291 338 409 548 665 825 1045 1194 1330 1559 1791 2098 2571 2968</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 24 LWS 68 104 169 218 291 338 409 548 665 825 1045 1194 1330 1559 1791 2098 2571 2968 <ins style="font-weight: bold; text-decoration: none;"> 3758</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 12 encephalopsin 67 110 181 216 286 350 454 625 842 1030 1289 1468 1762 1997 2303 2594 2867 3100</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 12 encephalopsin 67 110 181 216 286 350 454 625 842 1030 1289 1468 1762 1997 2303 2594 2867 3100 <ins style="font-weight: bold; text-decoration: none;"> 3655</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 13 melanopsin 24 70 132 160 207 244 317 424 540 651 802 913 1055 1214 1398 1637 1913 2091</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 13 melanopsin 24 70 132 160 207 244 317 424 540 651 802 913 1055 1214 1398 1637 1913 2091 <ins style="font-weight: bold; text-decoration: none;"> 2659</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 13 RGR.phyloSNPs 98 120 181 200 259 299 528 662 822 983 1178 1339 1532 1728 1995 2275 2639 2915</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 13 RGR.phyloSNPs 98 120 181 200 259 299 528 662 822 983 1178 1339 1532 1728 1995 2275 2639 2915 <ins style="font-weight: bold; text-decoration: none;"> 3810</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 16 peropsin 89 117 174 195 254 332 381 461 573 710 891 1072 1244 1444 1691 1965 2216 2493</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 16 peropsin 89 117 174 195 254 332 381 461 573 710 891 1072 1244 1444 1691 1965 2216 2493 <ins style="font-weight: bold; text-decoration: none;"> 3045</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 15 neuropsin 83 102 164 188 225 264 390 471 558 672 903 1097 1227 1467 1759 1985 2247 2471</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 15 neuropsin 83 102 164 188 225 264 390 471 558 672 903 1097 1227 1467 1759 1985 2247 2471 <ins style="font-weight: bold; text-decoration: none;"> 3192</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 08 platypus 290 338 488 574 743 868 978 1123 1324 1484 1743 1962 2300 2527 2889 3342 3790 4234</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 08 platypus 290 338 488 574 743 868 978 1123 1324 1484 1743 1962 2300 2527 2889 3342 3790 4234 <ins style="font-weight: bold; text-decoration: none;"> 4990</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 06 tricks 169 191 304 343 396 468 530 631 769 938 1253 1438 1622 1854 2113 2365 2697 3072</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 06 tricks 169 191 304 343 396 468 530 631 769 938 1253 1438 1622 1854 2113 2365 2697 3072 <ins style="font-weight: bold; text-decoration: none;"> 3950</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 27 cytoplasmic.face 0 0 0 0 0 0 91 132 277 445 670 814 977 1150 1346 1572 1861 2137</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 27 cytoplasmic.face 0 0 0 0 0 0 91 132 277 445 670 814 977 1150 1346 1572 1861 2137 <ins style="font-weight: bold; text-decoration: none;"> 2864</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 41 RPE.BCO2.BCMO1 0 0 0 0 0 0 85 163 261 447 592 691 869 993 1197 1461 1687 1839</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 41 RPE.BCO2.BCMO1 0 0 0 0 0 0 85 163 261 447 592 691 869 993 1197 1461 1687 1839 <ins style="font-weight: bold; text-decoration: none;"> 2436</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 20 IRBP.(RBP3) 0 0 0 0 0 0 0 339 772 968 1202 1310 1493 1643 1840 2053 2368 2679</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 20 IRBP.(RBP3) 0 0 0 0 0 0 0 339 772 968 1202 1310 1493 1643 1840 2053 2368 2679 <ins style="font-weight: bold; text-decoration: none;"> 3164</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 20 CDH23 0 0 0 0 0 0 0 0 0 162 326 474 709 945 1211 1741 2085 2490</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 20 CDH23 0 0 0 0 0 0 0 0 0 162 326 474 709 945 1211 1741 2085 2490 <ins style="font-weight: bold; text-decoration: none;"> 3296</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 28 USH2A 0 0 0 0 0 0 0 0 0 222 364 480 702 911 1178 1537 1830 2133</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 28 USH2A 0 0 0 0 0 0 0 0 0 222 364 480 702 911 1178 1537 1830 2133 <ins style="font-weight: bold; text-decoration: none;"> 2900</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 17 transducins 0 0 0 0 148 468 378 509 674 918 1164 1345 1538 1802 2063 2402 2722 2976</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 17 transducins 0 0 0 0 148 468 378 509 674 918 1164 1345 1538 1802 2063 2402 2722 2976 <ins style="font-weight: bold; text-decoration: none;"> 3437</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> <del style="font-weight: bold; text-decoration: none;">02 </del> underground 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 <del style="font-weight: bold; text-decoration: none;"> </del></div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> <ins style="font-weight: bold; text-decoration: none;">31 </ins> underground 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 <ins style="font-weight: bold; text-decoration: none;"> 782</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 03 blog 1178 1329 1798 2158 2610 3179 3412 3960 4599 5436 6211 7002 7860 9107 10354 11987 13540 15422</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 03 blog 1178 1329 1798 2158 2610 3179 3412 3960 4599 5436 6211 7002 7860 9107 10354 11987 13540 15422 <ins style="font-weight: bold; text-decoration: none;"> 18726</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> <del style="font-weight: bold; text-decoration: none;">503 </del> total 4741 5429 7084 8248 10437 12579 14219 17719 21890 26683 30298 35684 41640 48143 55892 65552 75621 85774</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> <ins style="font-weight: bold; text-decoration: none;">532 </ins> total 4741 5429 7084 8248 10437 12579 14219 17719 21890 26683 30298 35684 41640 48143 55892 65552 75621 85774 <ins style="font-weight: bold; text-decoration: none;">109255</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div><del style="font-weight: bold; text-decoration: none;"> </del>visits.per.day 31 34 22 31 36 39 49 74 61 50yr 38 61 65 66 69 80 102 87yr</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div><ins style="font-weight: bold; text-decoration: none;"> ... </ins>visits.per.day 31 34 22 31 36 39 49 74 61 50yr 38 61 65 66 69 80 102 87yr <ins style="font-weight: bold; text-decoration: none;"> 173</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> </div></td><td colspan="2" class="diff-side-added"></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>[[Category:Comparative Genomics]]</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>[[Category:Comparative Genomics]]</div></td></tr>
</table>
Tomemerald
https://genomewiki.ucsc.edu/index.php?title=Opsin_evolution:_update_blog&diff=19601&oldid=prev
Tomemerald at 03:30, 24 April 2012
2012-04-24T03:30:19Z
<p></p>
<table style="background-color: #fff; color: #202122;" data-mw="interface">
<col class="diff-marker" />
<col class="diff-content" />
<col class="diff-marker" />
<col class="diff-content" />
<tr class="diff-title" lang="en">
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">← Older revision</td>
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">Revision as of 03:30, 24 April 2012</td>
</tr><tr><td colspan="2" class="diff-lineno" id="mw-diff-left-l31">Line 31:</td>
<td colspan="2" class="diff-lineno">Line 31:</td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>[[Image:TMTsurvivors.png]]</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>[[Image:TMTsurvivors.png]]</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> Reverse Chronological Update Blog</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> Reverse Chronological Update Blog</div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> </div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div><ins style="font-weight: bold; text-decoration: none;"> </ins></div></td></tr>
<tr><td colspan="2" class="diff-side-deleted"></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div><ins style="font-weight: bold; text-decoration: none;"> 14 Apr 12: released major article on [[Cryptochrome_evolution|cryptochrome evolution]], relationships with opsins, with 275 curated [[Cryptochrome_refSeqs|reference sequence]]</ins></div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 15 Feb 12: started new article on opsins of an [[Opsins_underground|underground mammal]], naked mole-rat</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 15 Feb 12: started new article on opsins of an [[Opsins_underground|underground mammal]], naked mole-rat</div></td></tr>
<tr><td colspan="2" class="diff-side-deleted"></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div><ins style="font-weight: bold; text-decoration: none;"> </ins></div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 30 Dec 11: first nematode opsins located in [[Opsin_evolution:_key_critters_(ecdysozoa)#Nematodes_..._3_opsins|Strongyloides]]</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 30 Dec 11: first nematode opsins located in [[Opsin_evolution:_key_critters_(ecdysozoa)#Nematodes_..._3_opsins|Strongyloides]]</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 30 Sep 11: the earliest opsins -- added two full-length [[Opsin_evolution:_key_critters_(cnidaria)|ctenophore opsins]] with '''introns''' from Mnemiopsis assembly</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 30 Sep 11: the earliest opsins -- added two full-length [[Opsin_evolution:_key_critters_(cnidaria)|ctenophore opsins]] with '''introns''' from Mnemiopsis assembly</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 13 Aug 11: [[Opsin_evolution:_key_critters_(cnidaria)#Anthozoa:_Acropora_digitifera_.28stony_coral.29_.._13_opsins|first introns]] found in cnidarian opsins (new coral genome, Acropora digitifera) </div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 13 Aug 11: [[Opsin_evolution:_key_critters_(cnidaria)#Anthozoa:_Acropora_digitifera_.28stony_coral.29_.._13_opsins|first introns]] found in cnidarian opsins (new coral genome, Acropora digitifera) </div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 06 Mar 11: RH7 transcripts found <del style="font-weight: bold; text-decoration: none;">from a </del>[[Opsin_evolution:_key_critters_%28ecdysozoa%29#Hexapoda:_Drosophila_melanogaster_.28fruitfly.29_.._7_opsins|butterfly antenna]] -- new anatomical structure?</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 06 Mar 11: RH7 transcripts found <ins style="font-weight: bold; text-decoration: none;">in </ins>[[Opsin_evolution:_key_critters_%28ecdysozoa%29#Hexapoda:_Drosophila_melanogaster_.28fruitfly.29_.._7_opsins|butterfly antenna]] -- new anatomical structure?</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 02 Mar 11: First [[Opsin_evolution:_key_critters_%28deuterostomes%29#Snakes:_Python_molarus_.28python.29_.._11_opsins|snake genome]] has 11 opsins but 8 are lost</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 02 Mar 11: First [[Opsin_evolution:_key_critters_%28deuterostomes%29#Snakes:_Python_molarus_.28python.29_.._11_opsins|snake genome]] has 11 opsins but 8 are lost</div></td></tr>
<tr><td colspan="2" class="diff-side-deleted"></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div><ins style="font-weight: bold; text-decoration: none;"> </ins></div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 06 Oct 10: [[Opsin_evolution:_Neuropsin_phyloSNPs#NEUR4:_11_vertebrate_newwopsins|new opsin]] surfaces in non-amniote vertebrates -- a neuropsin related to NEUR4 in zebrafish and frog</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 06 Oct 10: [[Opsin_evolution:_Neuropsin_phyloSNPs#NEUR4:_11_vertebrate_newwopsins|new opsin]] surfaces in non-amniote vertebrates -- a neuropsin related to NEUR4 in zebrafish and frog</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 26 Aug 10: first ctenophore opsin now [[Opsin_evolution:_key_critters_%28cnidaria%29#Ctenophora:_Pleurobrachia_pileus_.28sea_gooseberry.29_.._2_opsins|extendable to full length]]; second ctenophore opsin surfaces</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 26 Aug 10: first ctenophore opsin now [[Opsin_evolution:_key_critters_%28cnidaria%29#Ctenophora:_Pleurobrachia_pileus_.28sea_gooseberry.29_.._2_opsins|extendable to full length]]; second ctenophore opsin surfaces</div></td></tr>
<tr><td colspan="2" class="diff-lineno" id="mw-diff-left-l51">Line 51:</td>
<td colspan="2" class="diff-lineno">Line 54:</td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 17 Jan 10: queried [[Opsin_evolution:_key_critters_%28ecdysozoa%29#Chelicerata:_Varroa_destructor_.28bee_mite.29_1_opsin|new chelicerate genome]] (Varroa bee mite) for opsins, finding only a peropsin-like fragment</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 17 Jan 10: queried [[Opsin_evolution:_key_critters_%28ecdysozoa%29#Chelicerata:_Varroa_destructor_.28bee_mite.29_1_opsin|new chelicerate genome]] (Varroa bee mite) for opsins, finding only a peropsin-like fragment</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> </div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> </div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 14 Jan <del style="font-weight: bold; text-decoration: none;">13</del>: snazzy new graphic shows gain and loss at 24 opsin loci during deuterostome history, vindicating 1942 GL Walls hypothesis</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 14 Jan <ins style="font-weight: bold; text-decoration: none;">10</ins>: snazzy new graphic shows gain and loss at 24 opsin loci during deuterostome history, vindicating 1942 GL Walls hypothesis</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 13 Jan 10: added section about 'managing' [[Opsin_evolution:_ancestral_introns#Managing_homoplasy_in_intron_data|homoplasy]] of indels, introns and diagnostic residues</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 13 Jan 10: added section about 'managing' [[Opsin_evolution:_ancestral_introns#Managing_homoplasy_in_intron_data|homoplasy]] of indels, introns and diagnostic residues</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 12 Jan 10: defined the [[Opsin_evolution:_ancestral_introns#Ancestral_introns|intronation required]] of a GPCR gene to be parental to an opsin family </div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 12 Jan 10: defined the [[Opsin_evolution:_ancestral_introns#Ancestral_introns|intronation required]] of a GPCR gene to be parental to an opsin family </div></td></tr>
</table>
Tomemerald
https://genomewiki.ucsc.edu/index.php?title=Opsin_evolution:_update_blog&diff=18080&oldid=prev
Tomemerald at 13:10, 15 February 2012
2012-02-15T13:10:12Z
<p></p>
<table style="background-color: #fff; color: #202122;" data-mw="interface">
<col class="diff-marker" />
<col class="diff-content" />
<col class="diff-marker" />
<col class="diff-content" />
<tr class="diff-title" lang="en">
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">← Older revision</td>
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">Revision as of 13:10, 15 February 2012</td>
</tr><tr><td colspan="2" class="diff-lineno" id="mw-diff-left-l31">Line 31:</td>
<td colspan="2" class="diff-lineno">Line 31:</td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>[[Image:TMTsurvivors.png]]</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>[[Image:TMTsurvivors.png]]</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> Reverse Chronological Update Blog</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> Reverse Chronological Update Blog</div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div><del style="font-weight: bold; text-decoration: none;"> </del></div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> </div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 15 Feb 12: started new article on opsins of an [[<del style="font-weight: bold; text-decoration: none;">Opsin_evolution:</del>Opsins_underground|underground mammal]], naked mole-rat</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 15 Feb 12: started new article on opsins of an [[Opsins_underground|underground mammal]], naked mole-rat</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 30 Dec 11: first nematode opsins located in [[Opsin_evolution:_key_critters_(ecdysozoa)#Nematodes_..._3_opsins|Strongyloides]]</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 30 Dec 11: first nematode opsins located in [[Opsin_evolution:_key_critters_(ecdysozoa)#Nematodes_..._3_opsins|Strongyloides]]</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 30 Sep 11: the earliest opsins -- added two full-length [[Opsin_evolution:_key_critters_(cnidaria)|ctenophore opsins]] with '''introns''' from Mnemiopsis assembly</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 30 Sep 11: the earliest opsins -- added two full-length [[Opsin_evolution:_key_critters_(cnidaria)|ctenophore opsins]] with '''introns''' from Mnemiopsis assembly</div></td></tr>
</table>
Tomemerald
https://genomewiki.ucsc.edu/index.php?title=Opsin_evolution:_update_blog&diff=18077&oldid=prev
Tomemerald at 12:44, 15 February 2012
2012-02-15T12:44:21Z
<p></p>
<table style="background-color: #fff; color: #202122;" data-mw="interface">
<col class="diff-marker" />
<col class="diff-content" />
<col class="diff-marker" />
<col class="diff-content" />
<tr class="diff-title" lang="en">
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">← Older revision</td>
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">Revision as of 12:44, 15 February 2012</td>
</tr><tr><td colspan="2" class="diff-lineno" id="mw-diff-left-l31">Line 31:</td>
<td colspan="2" class="diff-lineno">Line 31:</td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>[[Image:TMTsurvivors.png]]</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>[[Image:TMTsurvivors.png]]</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> Reverse Chronological Update Blog</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> Reverse Chronological Update Blog</div></td></tr>
<tr><td colspan="2" class="diff-side-deleted"></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div><ins style="font-weight: bold; text-decoration: none;"> </ins></div></td></tr>
<tr><td colspan="2" class="diff-side-deleted"></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div><ins style="font-weight: bold; text-decoration: none;"> 15 Feb 12: started new article on opsins of an [[Opsin_evolution:Opsins_underground|underground mammal]], naked mole-rat</ins></div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 30 Dec 11: first nematode opsins located in [[Opsin_evolution:_key_critters_(ecdysozoa)#Nematodes_..._3_opsins|Strongyloides]]</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 30 Dec 11: first nematode opsins located in [[Opsin_evolution:_key_critters_(ecdysozoa)#Nematodes_..._3_opsins|Strongyloides]]</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 30 Sep 11: the earliest opsins -- added two full-length [[Opsin_evolution:_key_critters_(cnidaria)|ctenophore opsins]] with '''introns''' from Mnemiopsis assembly</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 30 Sep 11: the earliest opsins -- added two full-length [[Opsin_evolution:_key_critters_(cnidaria)|ctenophore opsins]] with '''introns''' from Mnemiopsis assembly</div></td></tr>
<tr><td colspan="2" class="diff-lineno" id="mw-diff-left-l216">Line 216:</td>
<td colspan="2" class="diff-lineno">Line 218:</td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 28 USH2A 0 0 0 0 0 0 0 0 0 222 364 480 702 911 1178 1537 1830 2133</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 28 USH2A 0 0 0 0 0 0 0 0 0 222 364 480 702 911 1178 1537 1830 2133</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 17 transducins 0 0 0 0 148 468 378 509 674 918 1164 1345 1538 1802 2063 2402 2722 2976</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 17 transducins 0 0 0 0 148 468 378 509 674 918 1164 1345 1538 1802 2063 2402 2722 2976</div></td></tr>
<tr><td colspan="2" class="diff-side-deleted"></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div><ins style="font-weight: bold; text-decoration: none;"> 02 underground 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 </ins></div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 03 blog 1178 1329 1798 2158 2610 3179 3412 3960 4599 5436 6211 7002 7860 9107 10354 11987 13540 15422</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 03 blog 1178 1329 1798 2158 2610 3179 3412 3960 4599 5436 6211 7002 7860 9107 10354 11987 13540 15422</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 503 total 4741 5429 7084 8248 10437 12579 14219 17719 21890 26683 30298 35684 41640 48143 55892 65552 75621 85774</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 503 total 4741 5429 7084 8248 10437 12579 14219 17719 21890 26683 30298 35684 41640 48143 55892 65552 75621 85774</div></td></tr>
</table>
Tomemerald
https://genomewiki.ucsc.edu/index.php?title=Opsin_evolution:_update_blog&diff=17510&oldid=prev
Tomemerald at 14:01, 2 January 2012
2012-01-02T14:01:23Z
<p></p>
<table style="background-color: #fff; color: #202122;" data-mw="interface">
<col class="diff-marker" />
<col class="diff-content" />
<col class="diff-marker" />
<col class="diff-content" />
<tr class="diff-title" lang="en">
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">← Older revision</td>
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">Revision as of 14:01, 2 January 2012</td>
</tr><tr><td colspan="2" class="diff-lineno" id="mw-diff-left-l190">Line 190:</td>
<td colspan="2" class="diff-lineno">Line 190:</td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 27 Nov 07: reorganized curated sequences into deuterostome, ecdysozoa, lophotrochozoa blocks sorted by receptor type.</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 27 Nov 07: reorganized curated sequences into deuterostome, ecdysozoa, lophotrochozoa blocks sorted by receptor type.</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><br/></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><br/></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> site visits: 2008 ... 2009 ... 2010 2011</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> site visits: 2008 ... 2009 ... 2010 2011 <ins style="font-weight: bold; text-decoration: none;"> 2012</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> #pages topic 22 Apr 12 May 29 Jul 4 Sep 4 Nov 3 Jan 8 Feb 26 Mar 2 Jun 5 Sep 8 Dec 6 Mar 6 Jun 13 Sep 21 Jan 22 May 7 Sep</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> #pages topic 22 Apr 12 May 29 Jul 4 Sep 4 Nov 3 Jan 8 Feb 26 Mar 2 Jun 5 Sep 8 Dec 6 Mar 6 Jun 13 Sep 21 Jan 22 May <ins style="font-weight: bold; text-decoration: none;"> </ins>7 Sep <ins style="font-weight: bold; text-decoration: none;"> 2 Jan</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 47 main 814 896 1076 1227 1706 1919 2123 2380 2693 3128 3561 4181 4570 4938 5418 6091 6798</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 47 main 814 896 1076 1227 1706 1919 2123 2380 2693 3128 3561 4181 4570 4938 5418 6091 6798 <ins style="font-weight: bold; text-decoration: none;"> 7510</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 14 key.deuterostomes 0 0 107 170 250 385 447 631 907 1104 1460 1680 1835 2073 2377 2720 3222</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 14 key.deuterostomes 0 0 107 170 250 385 447 631 907 1104 1460 1680 1835 2073 2377 2720 3222 <ins style="font-weight: bold; text-decoration: none;"> 3718</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 32 key.ecdysozoa 1106 1207 1279 1351 1492 1685 1766 2009 2324 98 245 430 603 855 1121 1471 1877</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 32 key.ecdysozoa 1106 1207 1279 1351 1492 1685 1766 2009 2324 98 245 430 603 855 1121 1471 1877 <ins style="font-weight: bold; text-decoration: none;"> 2242</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 11 key.lophotrochozoa 0 0 0 0 0 0 0 0 0 121 305 432 621 794 1071 1376 1721</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 11 key.lophotrochozoa 0 0 0 0 0 0 0 0 0 121 305 432 621 794 1071 1376 1721 <ins style="font-weight: bold; text-decoration: none;"> 2020</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 25 key.cnidaria 0 0 0 120 209 320 391 515 731 974 1304 1562 1961 2316 2835 3505 4246</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 25 key.cnidaria 0 0 0 120 209 320 391 515 731 974 1304 1562 1961 2316 2835 3505 4246 <ins style="font-weight: bold; text-decoration: none;"> 5210</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div><del style="font-weight: bold; text-decoration: none;"> 4 </del> opsin.origins 0 0 0 0 0 0 0 0 0 0 0 294 524 761 1056 1395 1691</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div><ins style="font-weight: bold; text-decoration: none;"> 04 </ins> opsin.origins 0 0 0 0 0 0 0 0 0 0 0 294 524 761 1056 1395 1691 <ins style="font-weight: bold; text-decoration: none;"> 2085</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div><del style="font-weight: bold; text-decoration: none;"> 8 </del> alignment 231 256 304 324 380 429 475 555 636 731 872 966 1086 1237 1423 1593 1811</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div><ins style="font-weight: bold; text-decoration: none;"> 08 </ins> alignment 231 256 304 324 380 429 475 555 636 731 872 966 1086 1237 1423 1593 1811 <ins style="font-weight: bold; text-decoration: none;"> 1963</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 10 introns 180 202 252 274 340 396 455 548 637 777 980 1203 1435 1674 1891 2188 2485 </div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 10 introns 180 202 252 274 340 396 455 548 637 777 980 1203 1435 1674 1891 2188 2485 <ins style="font-weight: bold; text-decoration: none;"> 2708</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div><del style="font-weight: bold; text-decoration: none;"> 2 </del> indels 97 118 157 179 227 284 322 405 521 634 829 1070 1315 1505 1719 2060 2317 </div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div><ins style="font-weight: bold; text-decoration: none;"> 02 </ins> indels 97 118 157 179 227 284 322 405 521 634 829 1070 1315 1505 1719 2060 2317 <ins style="font-weight: bold; text-decoration: none;"> 2615</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 11 ancestral 247 269 318 351 414 476 520 628 765 901 1109 1267 1452 1649 1853 2139 2420</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 11 ancestral 247 269 318 351 414 476 520 628 765 901 1109 1267 1452 1649 1853 2139 2420 <ins style="font-weight: bold; text-decoration: none;"> 2683</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 24 LWS 68 104 169 218 291 338 409 548 665 825 1045 1194 1330 1559 1791 2098 2571</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 24 LWS 68 104 169 218 291 338 409 548 665 825 1045 1194 1330 1559 1791 2098 2571 <ins style="font-weight: bold; text-decoration: none;"> 2968</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 12 encephalopsin 67 110 181 216 286 350 454 625 842 1030 1289 1468 1762 1997 2303 2594 2867</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 12 encephalopsin 67 110 181 216 286 350 454 625 842 1030 1289 1468 1762 1997 2303 2594 2867 <ins style="font-weight: bold; text-decoration: none;"> 3100</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 13 melanopsin 24 70 132 160 207 244 317 424 540 651 802 913 1055 1214 1398 1637 1913</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 13 melanopsin 24 70 132 160 207 244 317 424 540 651 802 913 1055 1214 1398 1637 1913 <ins style="font-weight: bold; text-decoration: none;"> 2091</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 13 RGR.phyloSNPs 98 120 181 200 259 299 528 662 822 983 1178 1339 1532 1728 1995 2275 2639 </div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 13 RGR.phyloSNPs 98 120 181 200 259 299 528 662 822 983 1178 1339 1532 1728 1995 2275 2639 <ins style="font-weight: bold; text-decoration: none;"> 2915</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 16 peropsin 89 117 174 195 254 332 381 461 573 710 891 1072 1244 1444 1691 1965 2216</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 16 peropsin 89 117 174 195 254 332 381 461 573 710 891 1072 1244 1444 1691 1965 2216 <ins style="font-weight: bold; text-decoration: none;"> 2493</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 15 neuropsin 83 102 164 188 225 264 390 471 558 672 903 1097 1227 1467 1759 1985 2247</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 15 neuropsin 83 102 164 188 225 264 390 471 558 672 903 1097 1227 1467 1759 1985 2247 <ins style="font-weight: bold; text-decoration: none;"> 2471</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div><del style="font-weight: bold; text-decoration: none;"> 8 </del> platypus 290 338 488 574 743 868 978 1123 1324 1484 1743 1962 2300 2527 2889 3342 3790</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div><ins style="font-weight: bold; text-decoration: none;"> 08 </ins> platypus 290 338 488 574 743 868 978 1123 1324 1484 1743 1962 2300 2527 2889 3342 3790 <ins style="font-weight: bold; text-decoration: none;"> 4234</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div><del style="font-weight: bold; text-decoration: none;"> 6 </del> tricks 169 191 304 343 396 468 530 631 769 938 1253 1438 1622 1854 2113 2365 2697 </div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div><ins style="font-weight: bold; text-decoration: none;"> 06 </ins> tricks 169 191 304 343 396 468 530 631 769 938 1253 1438 1622 1854 2113 2365 2697 <ins style="font-weight: bold; text-decoration: none;"> 3072</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 27 cytoplasmic.face 0 0 0 0 0 0 91 132 277 445 670 814 977 1150 1346 1572 1861</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 27 cytoplasmic.face 0 0 0 0 0 0 91 132 277 445 670 814 977 1150 1346 1572 1861 <ins style="font-weight: bold; text-decoration: none;"> 2137</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 41 RPE.BCO2.BCMO1 0 0 0 0 0 0 85 163 261 447 592 691 869 993 1197 1461 1687 </div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 41 RPE.BCO2.BCMO1 0 0 0 0 0 0 85 163 261 447 592 691 869 993 1197 1461 1687 <ins style="font-weight: bold; text-decoration: none;"> 1839</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 20 IRBP.(RBP3) 0 0 0 0 0 0 0 339 772 968 1202 1310 1493 1643 1840 2053 2368</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 20 IRBP.(RBP3) 0 0 0 0 0 0 0 339 772 968 1202 1310 1493 1643 1840 2053 2368 <ins style="font-weight: bold; text-decoration: none;"> 2679</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 20 CDH23 0 0 0 0 0 0 0 0 0 162 326 474 709 945 1211 1741 2085</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 20 CDH23 0 0 0 0 0 0 0 0 0 162 326 474 709 945 1211 1741 2085 <ins style="font-weight: bold; text-decoration: none;"> 2490</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 28 USH2A 0 0 0 0 0 0 0 0 0 222 364 480 702 911 1178 1537 1830</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 28 USH2A 0 0 0 0 0 0 0 0 0 222 364 480 702 911 1178 1537 1830 <ins style="font-weight: bold; text-decoration: none;"> 2133</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 17 transducins 0 0 0 0 148 468 378 509 674 918 1164 1345 1538 1802 2063 2402 2722</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 17 transducins 0 0 0 0 148 468 378 509 674 918 1164 1345 1538 1802 2063 2402 2722 <ins style="font-weight: bold; text-decoration: none;"> 2976</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div><del style="font-weight: bold; text-decoration: none;"> 3 </del> blog 1178 1329 1798 2158 2610 3179 3412 3960 4599 5436 6211 7002 7860 9107 10354 11987 13540 </div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div><ins style="font-weight: bold; text-decoration: none;"> 03 </ins> blog 1178 1329 1798 2158 2610 3179 3412 3960 4599 5436 6211 7002 7860 9107 10354 11987 13540 <ins style="font-weight: bold; text-decoration: none;"> 15422</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 503 total 4741 5429 7084 8248 10437 12579 14219 17719 21890 26683 30298 35684 41640 48143 55892 65552 75621</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 503 total 4741 5429 7084 8248 10437 12579 14219 17719 21890 26683 30298 35684 41640 48143 55892 65552 75621 <ins style="font-weight: bold; text-decoration: none;"> 85774</ins></div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> visits.per.day 31 34 22 31 36 39 49 74 61 50yr 38 61 65 66 69 80 102</div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> visits.per.day 31 34 22 31 36 39 49 74 61 50yr 38 61 65 66 69 80 102 <ins style="font-weight: bold; text-decoration: none;"> 87yr</ins></div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><br/></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><br/></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>[[Category:Comparative Genomics]]</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>[[Category:Comparative Genomics]]</div></td></tr>
</table>
Tomemerald
https://genomewiki.ucsc.edu/index.php?title=Opsin_evolution:_update_blog&diff=17506&oldid=prev
Tomemerald at 15:35, 31 December 2011
2011-12-31T15:35:04Z
<p></p>
<table style="background-color: #fff; color: #202122;" data-mw="interface">
<col class="diff-marker" />
<col class="diff-content" />
<col class="diff-marker" />
<col class="diff-content" />
<tr class="diff-title" lang="en">
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">← Older revision</td>
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">Revision as of 15:35, 31 December 2011</td>
</tr><tr><td colspan="2" class="diff-lineno" id="mw-diff-left-l31">Line 31:</td>
<td colspan="2" class="diff-lineno">Line 31:</td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>[[Image:TMTsurvivors.png]]</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div>[[Image:TMTsurvivors.png]]</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> Reverse Chronological Update Blog</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> Reverse Chronological Update Blog</div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> </div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div><ins style="font-weight: bold; text-decoration: none;"> 30 Dec 11: first nematode opsins located in [[Opsin_evolution:_key_critters_(ecdysozoa)#Nematodes_..._3_opsins|Strongyloides]]</ins></div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 30 Sep 11: the earliest opsins -- added two full-length [[Opsin_evolution:_key_critters_(cnidaria)|ctenophore opsins]] with '''introns''' from Mnemiopsis assembly</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 30 Sep 11: the earliest opsins -- added two full-length [[Opsin_evolution:_key_critters_(cnidaria)|ctenophore opsins]] with '''introns''' from Mnemiopsis assembly</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 13 Aug 11: [[Opsin_evolution:_key_critters_(cnidaria)#Anthozoa:_Acropora_digitifera_.28stony_coral.29_.._13_opsins|first introns]] found in cnidarian opsins (new coral genome, Acropora digitifera) </div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 13 Aug 11: [[Opsin_evolution:_key_critters_(cnidaria)#Anthozoa:_Acropora_digitifera_.28stony_coral.29_.._13_opsins|first introns]] found in cnidarian opsins (new coral genome, Acropora digitifera) </div></td></tr>
<tr><td colspan="2" class="diff-lineno" id="mw-diff-left-l39">Line 39:</td>
<td colspan="2" class="diff-lineno">Line 39:</td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 26 Aug 10: first ctenophore opsin now [[Opsin_evolution:_key_critters_%28cnidaria%29#Ctenophora:_Pleurobrachia_pileus_.28sea_gooseberry.29_.._2_opsins|extendable to full length]]; second ctenophore opsin surfaces</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 26 Aug 10: first ctenophore opsin now [[Opsin_evolution:_key_critters_%28cnidaria%29#Ctenophora:_Pleurobrachia_pileus_.28sea_gooseberry.29_.._2_opsins|extendable to full length]]; second ctenophore opsin surfaces</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 03 Jul 10: analyzed the five opsins in the new [[Opsin_evolution:_key_critters_%28ecdysozoa%29#Hexapoda:_Atta_cephalotes_.28ant.29_.._5_opsins|leafcutter ant genome]], Atta cephalotes</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 03 Jul 10: analyzed the five opsins in the new [[Opsin_evolution:_key_critters_%28ecdysozoa%29#Hexapoda:_Atta_cephalotes_.28ant.29_.._5_opsins|leafcutter ant genome]], Atta cephalotes</div></td></tr>
<tr><td class="diff-marker" data-marker="−"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;"><div> 06 Jun 10: <del style="font-weight: bold; text-decoration: none;">found </del>the [[Opsin_evolution:_key_critters_%28cnidaria%29#Porifera:_Amphimedon_queenslandica_.28sponge.29_.._1_opsin|first sponge opsin]] in unassembled traces<del style="font-weight: bold; text-decoration: none;">, peropsin-like exon CVVVIFSFMICWSPYATFSLWYSYSDTSGIPLWVTALPVLAA<font color="red">K</font>LFCCINPVIYLVVSKRFR</del></div></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div> 06 Jun 10: the [[Opsin_evolution:_key_critters_%28cnidaria%29#Porifera:_Amphimedon_queenslandica_.28sponge.29_.._1_opsin|first sponge opsin]] in unassembled traces <ins style="font-weight: bold; text-decoration: none;">proves to be a Lottia contaminant</ins></div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 05 Apr 10: collected assembled salamander transcripts for [[Opsin_evolution:_trichromatic_ancestral_mammal#Opsin_454_transcripts_of_salamander_Ambystoma_tigrinum|12 opsin loci]] from a 454 project; amphibians remain poorly sampled</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 05 Apr 10: collected assembled salamander transcripts for [[Opsin_evolution:_trichromatic_ancestral_mammal#Opsin_454_transcripts_of_salamander_Ambystoma_tigrinum|12 opsin loci]] from a 454 project; amphibians remain poorly sampled</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 29 Mar 10: analyzed and classified the 41 'opsins' in the new Hydra genome -- all have lysine at 296 but lack full DRY</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 29 Mar 10: analyzed and classified the 41 'opsins' in the new Hydra genome -- all have lysine at 296 but lack full DRY</div></td></tr>
</table>
Tomemerald
https://genomewiki.ucsc.edu/index.php?title=Opsin_evolution:_update_blog&diff=16224&oldid=prev
Tomemerald at 15:18, 30 September 2011
2011-09-30T15:18:02Z
<p></p>
<table style="background-color: #fff; color: #202122;" data-mw="interface">
<col class="diff-marker" />
<col class="diff-content" />
<col class="diff-marker" />
<col class="diff-content" />
<tr class="diff-title" lang="en">
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">← Older revision</td>
<td colspan="2" style="background-color: #fff; color: #202122; text-align: center;">Revision as of 15:18, 30 September 2011</td>
</tr><tr><td colspan="2" class="diff-lineno" id="mw-diff-left-l32">Line 32:</td>
<td colspan="2" class="diff-lineno">Line 32:</td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> Reverse Chronological Update Blog</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> Reverse Chronological Update Blog</div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><br/></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><br/></td></tr>
<tr><td colspan="2" class="diff-side-deleted"></td><td class="diff-marker" data-marker="+"></td><td style="color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;"><div><ins style="font-weight: bold; text-decoration: none;"> 30 Sep 11: the earliest opsins -- added two full-length [[Opsin_evolution:_key_critters_(cnidaria)|ctenophore opsins]] with '''introns''' from Mnemiopsis assembly</ins></div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 13 Aug 11: [[Opsin_evolution:_key_critters_(cnidaria)#Anthozoa:_Acropora_digitifera_.28stony_coral.29_.._13_opsins|first introns]] found in cnidarian opsins (new coral genome, Acropora digitifera) </div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 13 Aug 11: [[Opsin_evolution:_key_critters_(cnidaria)#Anthozoa:_Acropora_digitifera_.28stony_coral.29_.._13_opsins|first introns]] found in cnidarian opsins (new coral genome, Acropora digitifera) </div></td></tr>
<tr><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 06 Mar 11: RH7 transcripts found from a [[Opsin_evolution:_key_critters_%28ecdysozoa%29#Hexapoda:_Drosophila_melanogaster_.28fruitfly.29_.._7_opsins|butterfly antenna]] -- new anatomical structure?</div></td><td class="diff-marker"></td><td style="background-color: #f8f9fa; color: #202122; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #eaecf0; vertical-align: top; white-space: pre-wrap;"><div> 06 Mar 11: RH7 transcripts found from a [[Opsin_evolution:_key_critters_%28ecdysozoa%29#Hexapoda:_Drosophila_melanogaster_.28fruitfly.29_.._7_opsins|butterfly antenna]] -- new anatomical structure?</div></td></tr>
</table>
Tomemerald